KEGG   Sinorhizobium fredii NGR234: NGR_c37150Help
Entry
NGR_c37150        CDS       T00888                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00071  Fatty acid degradation
rhi00280  Valine, leucine and isoleucine degradation
rhi00281  Geraniol degradation
rhi00310  Lysine degradation
rhi00360  Phenylalanine metabolism
rhi00362  Benzoate degradation
rhi00380  Tryptophan metabolism
rhi00410  beta-Alanine metabolism
rhi00627  Aminobenzoate degradation
rhi00640  Propanoate metabolism
rhi00650  Butanoate metabolism
rhi00903  Limonene and pinene degradation
rhi00930  Caprolactam degradation
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01212  Fatty acid metabolism
Module
rhi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NGR_c37150
   00650 Butanoate metabolism
    NGR_c37150
  Lipid metabolism
   00071 Fatty acid degradation
    NGR_c37150
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NGR_c37150
   00310 Lysine degradation
    NGR_c37150
   00360 Phenylalanine metabolism
    NGR_c37150
   00380 Tryptophan metabolism
    NGR_c37150
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NGR_c37150
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NGR_c37150
   00281 Geraniol degradation
    NGR_c37150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NGR_c37150
   00627 Aminobenzoate degradation
    NGR_c37150
   00930 Caprolactam degradation
    NGR_c37150
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NGR_c37150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 7793630
NCBI-ProteinID: YP_002828189
RhizoBase: NGR_c37150
UniProt: C3MCY8
Position
3923667..3924440
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETRGRVGLITLNRPQALNALNSTLMRELDAALKAFDADKGVGAIVITGSEKA
FAAGADIKEMQALGFVDSYLGDFLGGWEHVAGARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDASEAERAGLVARIV
APDKLLEEALAAAEKIASFSLPAVMMAKEAVSRSLEVTLAEGLRFERRLFQALFATEDQK
EGMAAFVAKRKAEFKHG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgagacacgcgggcgcgtcggcctgatcactctcaat
cggccgcaggcgctgaacgcgctgaattcgaccctgatgcgtgagctcgacgcagcattg
aaggctttcgatgcggacaagggggtcggcgcgatcgtcattaccggctcggaaaaggcc
ttcgccgccggtgccgatatcaaggaaatgcaggcgctcggtttcgtcgacagctatctt
ggtgattttctcggcggctgggagcacgttgccggcgcccgcaagccgatgatcgccgct
gtttccggctttgcactcggtggtggctgcgaacttgcgatgatgtgcgatttcatcatc
gcctcggagacggcgaaattcggccagccggaaatcaccttgggcgtcatccccggcatg
ggcgggtcgcagcgcctgacgcgggcggtcggcaaggcgaaggcgatggacctgatcctg
accggccgcatgatggacgcgagcgaggcggagcgtgccggcctcgttgcgcggatcgtc
gcgcccgacaagttgctggaagaggcgcttgccgctgccgagaagatcgcttccttctcg
cttccggcggtgatgatggcgaaggaagcggtcagccgctcgctggaagtcacccttgcc
gagggcctgcgtttcgagcggcgcctattccaggcgctgttcgccaccgaagaccagaag
gaggggatggccgccttcgtcgccaagcgtaaagcggaattcaaacacggatga

DBGET integrated database retrieval system