KEGG   Rhizobium favelukesii: LPU83_0709Help
Entry
LPU83_0709        CDS       T03046                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00071  Fatty acid degradation
rhl00072  Synthesis and degradation of ketone bodies
rhl00280  Valine, leucine and isoleucine degradation
rhl00310  Lysine degradation
rhl00362  Benzoate degradation
rhl00380  Tryptophan metabolism
rhl00620  Pyruvate metabolism
rhl00630  Glyoxylate and dicarboxylate metabolism
rhl00640  Propanoate metabolism
rhl00650  Butanoate metabolism
rhl00900  Terpenoid backbone biosynthesis
rhl01100  Metabolic pathways
rhl01110  Biosynthesis of secondary metabolites
rhl01120  Microbial metabolism in diverse environments
rhl01130  Biosynthesis of antibiotics
rhl01200  Carbon metabolism
rhl01212  Fatty acid metabolism
rhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPU83_0709 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LPU83_0709 (fadA)
   00640 Propanoate metabolism
    LPU83_0709 (fadA)
   00650 Butanoate metabolism
    LPU83_0709 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPU83_0709 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LPU83_0709 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPU83_0709 (fadA)
   00310 Lysine degradation
    LPU83_0709 (fadA)
   00380 Tryptophan metabolism
    LPU83_0709 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPU83_0709 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPU83_0709 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPU83_0709 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhl04147]
    LPU83_0709 (fadA)
Enzymes [BR:rhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPU83_0709 (fadA)
Exosome [BR:rhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPU83_0709 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDM56389
UniProt: W6R602
Position
complement(681000..682208)
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNGLDTSEVDDIIMGCVDP
VMEAGAVIPRGAAFEAGYSTKAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WDKGYFKNSVIPVKDQNGLMILDHDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVAIQA
HPEVERLTYVHHAGNSSGIVDGAAAVLLGSKAGGESMGLKPRCRIKAFANIGSDPALMLT
GPVDVTEKLLKRSSMTLADIDLFELNEAFAAVVLRYMQAFDIAHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttttcatttacgaccacgtgcgcaccccgcgcggccgtggcaagaaggac
ggttcgctgcacgaggtaccgtcggtgcggcttgccgccaagacgctcgaggcgatccgc
gaccgcaatggactcgatacgtctgaggtagacgacatcatcatgggctgcgtcgatcct
gtcatggaagccggcgcggtcatcccgcgcggcgctgccttcgaggccggctattccacc
aaggcgccgggcatgcagatctcgcgcttctgcgcatccggcctcgatgctgtgaatttc
ggcgccgccaagatcgcgcaaggcgccgacgacatcgtcattgccggcggcgtcgaaagc
atgtcgcgcgtcggcctcggcatgtcgggcggcgcctggttcatggatccgtcggtgaac
ttcccggcctatttcatgccgcagggcgtctcggccgatctcatcgccaccaagtacggt
ttttcgcgcgacgacgtcgatgcctatgcggtcgagagccagaagcgcgcggccaacgcc
tgggataagggctatttcaagaattccgtcatcccggtcaaggaccagaacggcctgatg
atccttgatcatgacgagcacatgcgcccaggcacggacatgcaggcgctggcaagcctc
aacccgtccttccagatgccgggcgaaatgggcggcttcgaggccgtcgcgatccaggct
catccggaggtcgagcgcctcacctacgtccaccacgccggcaattcttccggcatcgtc
gacggcgcggccgccgtgctccttggctcgaaggcgggcggcgagagcatggggctgaag
ccccgctgtcgcatcaaggccttcgccaatatcggctccgacccggcgctgatgctgacc
ggccctgtcgacgtcaccgagaagctcctgaaacgatcaagcatgacacttgccgacatc
gatctcttcgaactcaatgaagccttcgccgccgtcgtgctgcgctacatgcaggccttc
gacatcgcgcatgacaagatcaacgtcaacggcggcgccatcgcgatgggccatccgctc
ggcgccaccggcgcgatgatcctcggcacggtgctggacgaactggagcggcgcgacctc
aacaccgcgctcgtcaccctctgcatcggcgccggcatgggcacggcgaccatcatcgaa
cgcgtctaa

DBGET integrated database retrieval system