KEGG   Rhizobium favelukesii: LPU83_1003Help
Entry
LPU83_1003        CDS       T03046                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LPU83_1003 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhl01007]
    LPU83_1003 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rhl03016]
    LPU83_1003 (glyS)
Enzymes [BR:rhl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     LPU83_1003 (glyS)
Amino acid related enzymes [BR:rhl01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   LPU83_1003 (glyS)
Transfer RNA biogenesis [BR:rhl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LPU83_1003 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: CDM56679
UniProt: W6R6V8
Position
complement(983973..986636)
Genome map
AA seq 887 aa AA seqDB search
MDDGVAASFQFAQIDQALGEIAQLRIVQAAGHFLAITGDEGHRCSLVQQLDRRLGLIGPG
VDFGRDDSGKRAKVSGHESSCVSRKLRDHSGEKRQGNARRPYPQQHSTAGGCFCGCADAA
FFASRGDRFQTRLSGAFPTEGKESDMPDLLLELRSEEIPARLQRKAAGDLKKLVTDALVE
AGLSYEGAREYWTPRRLTLDIRGLTARSADVREEKKGPRTDANEKAIEGFLRGAGLSSIS
EAQIQSDPKKGDFYIAVISKPGRAAEAIISDVMPGIIRDFPWPKPMRWGAASAKPGSLRW
VRPLQSIVCTFGTEHEETVVIPFSIDGIVASNVTYGHRFHAPDAITVKRFDDYVANLEKA
KVILDADRRKDIILHDARDIAFASGLGLVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIP
ADIIRLTIKTNQKCFVTRPIGSDTLSSKFILVSNIQASDGGKEIIHGNGKVVRARLSDAL
HFWKRDQGNLPDLETLEASAKKFDLDLSKPLDQRMAKLNALNVTFHARLGTQGARVERIR
ALAAKLVMQIGADYKLVDRAAVLAKADLRTEAVGEFPELQGLMGRRYAALQGEDASVAAA
IEDHWKPMGPNDRVPEDKIAITVALADKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIR
ILLERKVRIPLLTPIASHMARIDADLLDRASAEKKLQGGDYMTSSAIVGDGMSRQLDLLS
FFHDRLKVYLRDQGARYDLIDAVVTPEADDLLMIARRVEALTAFITSEDGKNLLVGTKRA
TQILAAEEKKGTVIADGVSENLFRLDAEKELFAAITTASAEASTAVAKEDFRSAMEALSR
LRAPVDRFFDDVLVNDEEAAIRANRLALLRLIREATGTVADFSKISG
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
ttggacgatggtgtcgcggcgagcttccagttcgcgcagatagaccaggcgctcggcgag
attgcgcagctgcgtatcgtccaggccgccggtcacttccttgcgataacgggcgatgaa
gggcaccgttgctccctcgtccagcagctcgatcgccgccttggcctgatcgggccgggc
gttgatttcggaagagatgacagcggcaagcgagcgaaggtcagcggccatgagagttcc
tgcgtttcacgaaagttgcgggaccatagcggcgaaaagcggcaaggcaatgcccgacgt
ccctatccacagcaacatagcacggccggtggctgtttttgcggttgtgctgacgcggca
ttctttgctagcagaggcgaccgttttcagacccgccttagtggcgccttccccaccgaa
ggcaaggaaagtgacatgccagatctgctcctagaactccgctccgaagagatcccggcc
cgtttgcagcgcaaggctgccggcgacctgaagaagctcgtcaccgatgcgcttgttgaa
gcaggactgtcctacgagggtgcgcgcgaatactggacgccgcgccggctgacactcgac
attcgtggcctgacggcgcgctccgccgacgtgcgcgaagagaagaagggcccccgcacc
gacgccaacgagaaggcgatcgaaggcttcctgcgcggcgccggcctgtcctccatttcc
gaggcgcagatccagagcgacccgaagaagggcgacttctacatcgccgtcatctccaag
ccgggccgcgccgccgaagcgatcatcagtgacgtgatgcccggcatcatccgcgatttc
ccctggccgaagccgatgcgctggggtgctgcatccgccaagcccggttcgctgcgctgg
gtgcggccgctgcagtcgatcgtctgcacattcggcaccgagcatgaggaaacggttgtc
attccgttttcgatcgacggcatcgtcgcctccaacgtgacctacggccaccgcttccat
gcgcctgatgccatcaccgtcaagcgcttcgacgattatgtcgccaatctcgaaaaggcg
aaggtcattcttgatgccgatcggcgcaaggacatcatcctgcacgacgcccgcgacatc
gcgtttgcgagcggccttggcctggtcgaggacgagggcctgttggaagaggtctccggt
ctcgtcgaatggccgcaggtgctgatgggaagcttcgaggaagactacctctcgatcccg
gccgacatcatccgcctgacgatcaagacgaaccagaagtgcttcgtgacgcgcccgatc
ggcagcgacacgctttccagcaagttcatcctcgtttcgaacatccaggcgagcgatggc
ggcaaggagatcatccacggcaacggcaaggtcgtgcgggcccgtctttccgacgcgcta
cacttctggaagcgcgaccagggcaatctgccggacctcgaaacgctggaagcttcggcg
aagaaattcgacctcgacctctccaagccgcttgaccagcgcatggccaagctcaacgcg
ctcaacgtgaccttccacgccaggctcggaacgcagggcgcacgcgtggagcgcatccgc
gcgcttgcggccaagctcgtcatgcagatcggcgcagactacaagcttgtcgaccgggcc
gcggttctggccaaggcggatcttcgcaccgaggccgtcggcgagtttccggaactgcag
ggcctgatgggccgccgctatgccgcgctccagggcgaggacgcctcggtcgcagcagcg
atcgaggatcactggaagccgatggggccgaacgaccgcgttccggaggacaagattgcg
atcaccgtcgcgctcgccgacaagctcgatacgctgaccggcttctgggctatcgacgag
aagcccaccggctccaaggatcccttcgcgcttcgccgcgcagcactcggcgtcatccgc
atcctgctcgagcgcaaggttcgtatcccgctgctaacgccgattgcctcgcacatggcg
cggatcgatgcagatctcctagacagagcatccgccgaaaagaagctccaaggtggcgac
tacatgacaagcagtgctatcgtcggcgatgggatgtcacgtcaactcgacctcctctcc
ttcttccacgaccgcctcaaggtctatctgcgcgaccaaggcgcgcgctacgacctgatt
gacgccgtggttacgcccgaagccgacgatcttctgatgattgcccgccgtgtcgaggcg
ctgacggcgttcattacctcggaggacggtaaaaatctcctggtcggcaccaagcgcgcc
acgcaaattctggctgccgaggagaagaagggcacggtgatcgccgacggcgtctccgaa
aacctcttccgcctcgacgccgagaaggagctctttgccgccatcaccacggcttccgcg
gaagcctcaacggccgttgcaaaggaagacttccgctcggcgatggaagcactctccagg
ctgcgcgcaccggtcgaccgcttcttcgacgacgtgttggtcaatgacgaagaggccgcc
attcgcgccaatcgtcttgccctgctgcgcctgatccgcgaggcaaccggcaccgtcgcc
gacttctcgaagatctcgggctaa

DBGET integrated database retrieval system