KEGG   Rhizobium favelukesii: LPU83_2066Help
Entry
LPU83_2066        CDS       T03046                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00051  Fructose and mannose metabolism
rhl01100  Metabolic pathways
rhl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LPU83_2066
Enzymes [BR:rhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     LPU83_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Kin17_mid
Motif
Other DBs
NCBI-ProteinID: CDM57723
UniProt: W6RG88
Position
1990176..1991453
Genome map
AA seq 425 aa AA seqDB search
MTRITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVVLETDESGLSGHGLTFTIGRGND
ICCMAIEAMRHLIVGAELADVLAHPGKFWRHLTSDSQLRWIGPEKGVMHLATGAVVNAVW
DLLAKQAGKPVWRLVAEMSPEAIADIVDYRYLTDVLTRDEAIEILKRAETGKAERIATLE
TEGYACYTTSAGWLGYDDAKLRRLCQEAIDAGFNHVKMKVGRDLEDDVRRLRIAREVIGP
DRYLMIDANQVWEVGQAIDWVNKLAFAMPFFIEEPTSPDDVAGHRKIRQAIGPVKVATGE
MCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLSVLLVAAKFGLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKDGRVIEYVDHLHEHFLDPCVIKDAAYMPPQKPGFSIEMKPASIAD
YTFRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcaccgaccttcgcgtcttcgaccttcgttttccgacgtcgcagagcctt
gatggctctgacgcgatgaacccggatcccgattattcggcggcctatgtcgtcttggag
accgatgaaagcggcctgtccggccacgggctcaccttcaccatcggccgcggcaacgac
atctgctgcatggcgatcgaggcgatgcgccatctcatcgtcggcgctgagcttgccgat
gttcttgctcatccaggcaaattctggcggcatctcaccagcgacagccaactgcgctgg
atcgggccggagaagggcgtgatgcatctcgcgacaggcgctgtcgtcaacgccgtctgg
gatctgctcgccaagcaggccggcaagcccgtctggagactggtggcggagatgtcgccg
gaggcgatcgccgacattgtcgactatcgctatctgaccgatgttttgacccgcgatgag
gcgatcgagattctgaagcgcgcggagactgggaaggccgagcggatcgcgacgctcgag
acggaaggttatgcctgctacacgacctcggcaggttggcttggttacgacgatgcgaag
ctgcgccgcctgtgccaggaagcgatcgacgcgggcttcaaccatgtgaagatgaaggtc
ggccgcgacctcgaagacgatgtccgtcgcttgaggatcgcccgcgaagtgataggtccc
gaccgttacttgatgatcgatgccaaccaggtatgggaggtggggcaggcgatcgattgg
gtgaacaaactcgctttcgccatgccgttcttcatcgaggagccgacgagtccggacgat
gttgccggccatcgcaagatccgccaggcgatcggtcccgtgaaggtcgccaccggcgaa
atgtgccagaaccgcatcatgttcaagcaattcatcgctgaaggcgcgatcgatatcgtg
cagatcgactcctgccgcatggggggcttgaacgaagtactgtctgtcctgctggtcgca
gcgaagttcgggctaccggtctggccgcatgcgggcggcgtcgggctttgcgaatatgta
caacacctgtcgatgatcgactacgtcgccgtttccggaacaaaggacgggcgcgttatc
gaatatgtcgatcacctgcacgagcacttcctcgatccctgcgtgatcaaggatgcggcc
tatatgccgccgcaaaagccgggcttctccattgagatgaaacctgcttcgatcgccgac
tatacgtttcggggatag

DBGET integrated database retrieval system