KEGG   Rhizobium favelukesii: LPU83_2448Help
Entry
LPU83_2448        CDS       T03046                                 

Definition
(GenBank) simple sugar transport system ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LPU83_2448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhl02000]
    LPU83_2448
Enzymes [BR:rhl01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     LPU83_2448
Transporters [BR:rhl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    LPU83_2448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_30 AAA_29 RsgA_GTPase AAA_22 AAA_27 AAA_16 DUF815 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CDM58103
UniProt: W6RH80
Position
2387832..2389355
Genome map
AA seq 507 aa AA seqDB search
MIHDFENVLTASGISKFFPGAIALDKVDFSLRKGEVHALLGENGAGKSTLIKCITGAYHR
DQGRLALDGAEINPSDTLAAQKLGIGTVYQEVNLLPNLSIAENLSLGRQPKRFGMIDVRA
MNRQARALLEQYGMDVDVTAQLDRFSVAVQQVVAIARAVDLSGKVLILDEPTASLDTQEV
AMLFRIMRDLKERGLGIVFITHFLEQVYEVSDRITVLRNGKLVGTRETSELSRQSLISMM
LGHELANAEATARAHSVTAGPVKYRFEGYGKRGKVKPFNLEVRVGEVVGVAGLLGSGRTE
TAELLFGIEQADSGTAQVDGKQVALSNPRAAIRSGFGFCPEDRKTDGIIGDLSIRENIAL
ALQARRGWARPISRADQNALADRYISALDIRTTDREKPIRLLSGGNQQKAILARWLATNP
DFLILDEPTRGIDVGAHAEIIRLIEDLCAKGMSLIVISSELEELIAYSSRILVLRDREHV
AELTGDNVNTARIVDAIAAAQKKTEDA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatttcgagaacgttctaaccgcctccgggatatcgaaattcttcccgggc
gccattgcgctcgacaaggtcgatttctcgctgcgcaagggcgaggtgcatgcgcttctg
ggcgaaaacggtgccggaaaatcaacgctcatcaaatgcattacgggtgcctatcaccgc
gatcagggcaggcttgctctcgatggcgccgaaatcaatccgtccgatacgctcgcggcc
cagaagctcggcatcggcacggtgtatcaggaggtcaatctcctccccaatctgagcatc
gccgagaacctatccctcgggcgccagccgaagcggttcggcatgatcgatgtacgggcg
atgaaccggcaggcgcgggcactgcttgagcaatacgggatggacgtcgatgtgaccgcg
caactcgaccggttttcggtcgcagtgcagcaggtcgtggcgatcgcgcgcgctgtcgat
ttatcgggtaaagtcctcattctcgacgagccgactgcaagccttgacacgcaggaagtc
gcgatgctctttcgtatcatgcgggacttgaaagaacgcggccttggcattgtctttatt
actcatttcctggagcaggtttatgaggtcagtgatcgcatcacagtgctgagaaatggc
aagttggtcggcactcgcgaaacatccgagctgtctcgccagagcctgatctcgatgatg
ctcggtcatgaattggcgaatgccgaagcaacagcgcgggcgcattcggttacggccggt
ccggtcaaatacaggttcgaaggctacggcaagcgtggcaaggtgaagccgttcaacctt
gaggtccgcgtcggcgaggtggtgggcgttgcaggcttgctcgggtccggccgcacggag
actgccgagttgcttttcgggatcgagcaggctgacagtggaacggcacaagtcgacggt
aagcaggttgcgctctcgaatccgcgtgcggccatccgcagcggcttcggtttctgtccg
gaggatcgcaagacggacgggatcatcggcgacctttccattcgcgagaacattgccctg
gcgctgcaagcacggcgaggctgggcccggccgatttctcgcgccgatcaaaacgccctg
gccgaccgctacatcagtgcgctcgacatccggacgacagacagggagaagccgatacgt
ctgctgtcaggcggcaatcagcagaaagcgattcttgcgcgctggctggccaccaatccg
gacttcctgatcctcgacgagccgacccgcggcatcgacgtcggcgcacatgccgagatt
atccgcttgatcgaagatctctgcgcgaagggcatgtcactgatcgttatttcttcggaa
ttggaagaacttatcgcctatagctcacgtatcttggtccttcgcgatcgcgagcatgtc
gcggaactgacgggagacaatgtcaacaccgcgcgcatcgtcgacgccatcgctgccgcc
caaaagaagacggaggacgcatga

DBGET integrated database retrieval system