KEGG   Rhizobium favelukesii: LPU83_3680Help
Entry
LPU83_3680        CDS       T03046                                 

Gene name
btuE
Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00480  Glutathione metabolism
rhl00590  Arachidonic acid metabolism
rhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LPU83_3680 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPU83_3680 (btuE)
Enzymes [BR:rhl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LPU83_3680 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CDM59323
UniProt: W6RKA6
Position
complement(3641710..3642258)
Genome map
AA seq 182 aa AA seqDB search
MTDILNVPVKLADGRETTLNDHRGKVMLVVNVASKCGLTVQYEGLEKLYEDKRERGFVIA
AFPANNFKGQEPGTDAEIVEFCTLTYDVKFPIFSKISVKGEDKHPLYQLLTAAAGTAIGE
GPMRERLRNNGLASGDNSEILWNFEKFLVGRDGKVAARFAPDVTAEDQRLVSAIDKELAR
TA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattttgaatgtacccgtgaagctggctgatggtcgcgagacgactttgaac
gatcaccgtggcaaggtgatgctggtcgtcaatgtcgcctccaaatgtggtctgaccgtc
cagtacgaagggcttgagaagctctatgaggacaagcgcgagcgcggcttcgtgattgcc
gcctttccggcaaacaatttcaaggggcaggagcctggcacggatgccgagatcgtcgaa
ttctgcaccctgacctacgacgtgaaattcccgatcttctcgaagatctcggtaaagggc
gaggacaagcacccgctttaccaactgctgacagccgctgccggtactgccattggcgag
ggtccgatgcgggagcggctgcgcaacaacggcctggcgagcggcgacaacagtgaaatc
ctctggaatttcgaaaagtttctggtcggtcgcgacggcaaggtggctgcgcggtttgcg
ccggatgtcaccgccgaggatcagcggctggtctcggcgatcgacaaggagcttgcaagg
accgcctga

DBGET integrated database retrieval system