KEGG   Rhizobium favelukesii: LPU83_4083Help
Entry
LPU83_4083        CDS       T03046                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00071  Fatty acid degradation
rhl00072  Synthesis and degradation of ketone bodies
rhl00280  Valine, leucine and isoleucine degradation
rhl00310  Lysine degradation
rhl00362  Benzoate degradation
rhl00380  Tryptophan metabolism
rhl00620  Pyruvate metabolism
rhl00630  Glyoxylate and dicarboxylate metabolism
rhl00640  Propanoate metabolism
rhl00650  Butanoate metabolism
rhl00900  Terpenoid backbone biosynthesis
rhl01100  Metabolic pathways
rhl01110  Biosynthesis of secondary metabolites
rhl01120  Microbial metabolism in diverse environments
rhl01130  Biosynthesis of antibiotics
rhl01200  Carbon metabolism
rhl01212  Fatty acid metabolism
rhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPU83_4083 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    LPU83_4083 (phbA)
   00640 Propanoate metabolism
    LPU83_4083 (phbA)
   00650 Butanoate metabolism
    LPU83_4083 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    LPU83_4083 (phbA)
   00072 Synthesis and degradation of ketone bodies
    LPU83_4083 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPU83_4083 (phbA)
   00310 Lysine degradation
    LPU83_4083 (phbA)
   00380 Tryptophan metabolism
    LPU83_4083 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPU83_4083 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPU83_4083 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPU83_4083 (phbA)
Enzymes [BR:rhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPU83_4083 (phbA)
Exosome [BR:rhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPU83_4083 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DUF348 ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM59718
UniProt: W6RLA1
Position
complement(4057329..4058510)
Genome map
AA seq 393 aa AA seqDB search
MSSSSIVIASAGRTAVGSFNGAFATVPAHELGAAAVKGALERAGVEAGEVDEVILGQVLP
AGEGQNPARQAAMKAGVPKEATAWGVNQLCGSGLRAVALGMQQIALGDAKIIVAGGQESM
SMAPHAAHLRGGVKMGDMKMVDTMIKDGLTDAFYGYHMGITAENIARQWQLSREEQDRFA
VASQNKAEAAQKAGRFSDEIIPFVIQTRKGDVTVDADEYIRYGATLDSMAKLRPAFDKDG
TVTAANASGLNDGAAAAVLMTEAEASRRGIQPLVRVVSWATAGVDPQLMGTGPIPASRKA
LEKAGWSVGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGAKKGLATLCIGGGMGVAMCFEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttcatccatcgtcatcgctagtgcaggtcgcactgccgttggctcattcaat
ggcgccttcgccaccgttccggcccatgaactgggtgcggctgcggtcaagggcgcgctg
gagcgtgcaggtgtcgaggccggcgaagtcgatgaagtcattctcggtcaggttcttccg
gccggcgaaggccagaaccccgcccgccaggcggccatgaaggccggcgttcccaaggaa
gcgaccgcatggggcgtcaaccagctctgtggctcgggtcttcgcgccgtcgcgctcggc
atgcagcagatcgcgctcggtgatgcaaagatcatcgtcgcgggcggccaagagtcgatg
tcgatggcgccgcatgcggcgcatttgcgaggcggcgtgaaaatgggcgacatgaagatg
gtcgacaccatgatcaaggacggcctgacagatgccttctatggctatcacatgggcatc
accgccgagaacatcgcgcgccagtggcagctctcccgcgaggagcaggaccgatttgcc
gtcgcgtcgcagaataaggcggaagccgcgcaaaaggccggccgattcagcgatgaaatc
atccccttcgtcatccagacacgaaagggcgacgtgacggttgatgccgacgagtacatc
cgctacggcgcgacgttggactcgatggccaaactgcgcccggctttcgacaaggacggc
acggttaccgcagcgaatgcctccggcctgaacgatggcgccgccgcagccgtgctgatg
accgaggccgaagcctcccgtcggggcatccagccgctcgtccgcgttgtctcctgggcg
acagcaggcgttgatccgcagctcatgggaaccggcccgatcccggcgtcgcgcaaggcg
ctggagaaggcgggctggtctgtcggcgatctcgatctcgtcgaagcgaacgaagccttc
gccgcgcaggcctgtgcggtcaacaaggacctcggctgggatccttcgattgtcaacgtc
aacggtggtgcgatcgcgatcggccatccaatcggcgcttccggcgcgcgggtgctcaat
acgctccttttcgagatgaagcgccgtggcgcgaagaagggattggcgacgctctgcatc
ggtggcgggatgggcgtcgcaatgtgtttcgaagctctttga

DBGET integrated database retrieval system