KEGG   Rhizobium favelukesii: LPU83_pLPU83c0499Help
Entry
LPU83_pLPU83c0499 CDS       T03046                                 

Gene name
pit
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rhl  Rhizobium favelukesii
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LPU83_pLPU83c0499 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Position
pLPU83c:complement(466481..467485)
Genome map
AA seq 334 aa AA seqDB search
MEATLAFPLLAGLIAVALFFDFLNGLHDAANSIATIVSTRVLRPQYAVLWAAFFNFIAFL
FFGLHVAETLGTGIIDPGIVTPQVIFAALMGAIVWNIVTWMFGIPSSSSHALVGGLVGSG
LAKTGTSAIVWSGLLKTAGAIVLSPLLGFVLALFLVLCVTWIFLRQTPFFVDSTFRVLQF
VSASLYSLGHGGNDAQKTMGIIAVLLYSQGYGGGEFHVPFWVVLSCQSAMALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGALTLFAATWLGIPVSTTHTITGAIIGVGAARRLSAV
RWGLAGNIVVAWVITLPATAAIAALTYQIVNSIG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaccctcgcattcccgcttcttgcgggccttatcgcggtcgcgttgtttttc
gattttttgaacggactgcacgatgccgccaactcgattgccaccatcgtctcgacccgg
gtcttgcggccgcaatatgcggtattgtgggccgccttcttcaatttcatcgccttcctg
ttcttcggcctgcatgtggcagaaacactgggcaccggtatcatcgatccaggtatcgtc
acgccgcaagtcatcttcgccgcgctgatgggcgccatcgtctggaatatcgtcacctgg
atgttcggcataccgtcgagttcctcgcatgcgctggtcggtggcctggtcggttccggg
ttggccaaaaccggtacgagcgccattgtatggtcggggttattgaaaacggccggcgct
atcgtgctatctccgcttctgggcttcgttctggcgcttttccttgtcctgtgcgtgaca
tggatcttcctccggcagacgccctttttcgtcgacagcacatttcgcgtcctgcagttt
gtctccgcttccctctattcgctcggccatggtggtaacgacgcccagaagacaatgggg
atcatcgccgtgcttctctactcacagggttacggcggaggggaattccacgtgcctttc
tgggtcgtcctgtcctgccaatccgcaatggcgctcggaacattgttcggcggctggcgg
atcgttcatacgatgggctccaagatcacacggctgaatccaatgcagggcttctgcgcg
gagacaggtggcgcgctgacgttgtttgccgcgacatggctcggtatccccgtctcgacg
acccatacgatcacaggtgcaatcatcggcgtcggcgccgcacggcgcctttccgcggta
cggtggggattggcgggcaacatcgtcgtcgcgtgggtgataactctgcccgctactgcg
gccattgcggcactaacctatcagatcgtgaacagtatcgggtga

DBGET integrated database retrieval system