KEGG   Rhizobium favelukesii: LPU83_pLPU83d1105Help
Entry
LPU83_pLPU83d1105 CDS       T03046                                 

Gene name
noeJ
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00051  Fructose and mannose metabolism
rhl00520  Amino sugar and nucleotide sugar metabolism
rhl01100  Metabolic pathways
rhl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LPU83_pLPU83d1105 (noeJ)
   00520 Amino sugar and nucleotide sugar metabolism
    LPU83_pLPU83d1105 (noeJ)
Enzymes [BR:rhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     LPU83_pLPU83d1105 (noeJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Position
pLPU83d:complement(1090244..1091671)
Genome map
AA seq 475 aa AA seqDB search
MTKKIVPVIMAGGKGTRLWPLSRAAAPKQFIQFIGDKTLFQETLQRVSDPALYEAPVVLT
NEEFRFLVAEQARELDIGLAAILLEPVARNTAAAVAAAATLVSKRFDQDTIMHVLGSDYE
IVADDTYFDCVRIAAATAAEGKLVTFGIQPTEPATGYGYIEGGEALTTGARVVARFIEKP
PLAKAEEMLAAGSFYWNSGMFMFSVSCLLDELRTHAPETIKAAGEAVANAKTDLDFTRLD
RSAFSAAPNISIDYAIMEKTSNAAVVPSPFKWSDLGSWDSVWKSGSRDEHGNVAAANTTV
VNTKNSLIMTHGVHLAVQGMDDIAVIASEDAVYVGRLQDSQDVGSIVKMLAAAPSTSQLT
ETHPTSYRPWGGYTSVLNGDRFQVKRIFVTPGKKLSLQKHHHRSEHWIVVKGTAEVTIGE
NVQMLRENESVYIPLGEIHRLANPGKIMLELIEVQTGSYLGEDDIIRIVDEFGRS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaagatcgttcccgtgattatggctggcggtaagggcacgcgcctctggccg
ctgtcgcgtgctgcagcaccgaagcaattcatacagtttatcggcgacaagacacttttc
caggagacactgcagcgcgtgtccgatccggcgctctacgaggctcctgtcgttctcacc
aacgaagagtttcgctttctcgtcgccgagcaggcacgcgaactggacattggcctcgcc
gccattctgctcgaaccggtcgcccgcaacaccgctgccgccgttgcagcggctgcgacg
ctggtgagcaaacgctttgaccaagacacaatcatgcatgtgcttggctccgactatgag
atcgtcgccgacgacacctattttgactgcgtccgcatcgcagctgcgacagccgccgaa
ggcaagctcgtgacgttcggcatccagccgaccgagccggcaaccggctacggctatatc
gaaggcggagaagcgctgacgaccggtgcaagggtggtggcacgcttcatcgaaaaaccg
ccgctcgccaaggcggaagagatgctcgccgcaggcagcttctattggaactccggtatg
ttcatgttctcggtttcgtgtctgctcgatgaattgcgcacccacgctcccgaaacgata
aaggcggccggagaggccgtcgcaaacgccaagacagatcttgattttacgcgcctcgat
cggtcagcgttttccgccgcgccgaacatctcgatcgactacgccatcatggaaaagacg
agcaacgccgccgtcgtcccctcgcccttcaagtggtccgatctcggcagctgggattcc
gtctggaagagcggcagccgcgacgagcatggcaatgtggcggccgccaatacgaccgtc
gtcaataccaagaactcgctcatcatgacacatggcgtgcatctcgccgtccagggcatg
gacgacatcgccgtcatcgccagcgaggacgccgtctatgtcggccggttgcaggacagc
caggacgttggaagcatcgtgaaaatgctcgctgccgccccatcgacatcgcagctgacc
gagacgcacccgacctcctaccggccgtggggtggctacacgtccgtgctgaacggcgac
cgcttccaggtcaagcgcatcttcgtcacgccgggcaagaagctgtcgctgcagaagcac
catcaccgctccgagcattggatcgtcgtcaagggcacggccgaggtgacgatcggcgaa
aacgtgcagatgctcagggaaaacgaatccgtctacattccgctcggagaaatccatcgc
ttggccaaccccggcaagatcatgcttgaactgatcgaagtccagaccggatcctatctc
ggcgaagacgatatcatccgcatcgtcgacgagttcgggcgcagctga

DBGET integrated database retrieval system