KEGG   Rhodovulum sp. MB263: B5V46_06845Help
Entry
B5V46_06845       CDS       T04771                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm00860  Porphyrin and chlorophyll metabolism
rhm01100  Metabolic pathways
Module
rhm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B5V46_06845
Enzymes [BR:rhm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     B5V46_06845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARC88348
UniProt: A0A1V0HWT5
Position
1428184..1428696
Genome map
AA seq 170 aa AA seqDB search
MGLILLRHTRPDVAEGTCYGRTDYPPATSFAEEAAEVLATLPAIDRILTSPLLRCTCLAE
HIGAARGLPVEPDPRLIEIDFGAWEGIPWSEVPRDGLDHWAGHFYESRPHGGESVGMFFA
RVVPFLEEMRGPGRVLAVSHAGLMRAALHHAGREGAWQMKFPYGSFIELP
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatcctgttgcgccacacccggccggatgtcgccgagggcacctgctatggc
cgcaccgactacccgccggcgacaagctttgccgaggaggcggccgaggtgctggcgacg
ctgcccgccatcgaccggatcctgaccagcccgcttctgcgctgcacctgcctggccgag
catatcggcgcggcgcgggggctgccggtcgaacccgatccgcgcctgatcgagatcgat
ttcggtgcctgggaaggtatcccctggtccgaggtcccgcgcgacgggctcgatcactgg
gcggggcatttctacgagtcgcgcccccatggcggcgaaagcgtcggcatgttctttgcc
cgcgtcgtgccctttctcgaagagatgcgcgggcccgggcgggtgcttgccgtctcgcat
gccgggctgatgcgggccgcgttgcatcatgccgggcgcgaaggggcctggcagatgaag
ttcccctatgggagtttcatcgaactgccctga

DBGET integrated database retrieval system