KEGG   Rhodovulum sp. MB263: B5V46_08620Help
Entry
B5V46_08620       CDS       T04771                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm00480  Glutathione metabolism
rhm00590  Arachidonic acid metabolism
rhm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    B5V46_08620
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5V46_08620
Enzymes [BR:rhm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     B5V46_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ARC88674
UniProt: A0A1V0HXI4
Position
1835719..1836246
Genome map
AA seq 175 aa AA seqDB search
MRPAILPVVAALLFGAGSASAAESFRFSSIDGGEIDLAAFRGRPVLVVNTASQCGFTPQY
DGLQALQDSYGPRGLVVLAVPSDDFNQELADEAAVKDFCEVNFGLTLPMTEITHVKGAEA
HPFYRWMAEEHDFKPGWNFNKVLLDGSGNPVATFGAFTKPQSAKLTSKIETLLSQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctgccattcttccggttgtcgccgccctgttgttcggtgcgggctctgcctct
gccgccgagagcttccggttttcctcgatcgatggcggcgagatcgacctcgcggcgttc
cgcggccggccggtgctggtggtcaataccgcctcgcaatgcggtttcaccccgcaatat
gacgggttgcaggcgttgcaggacagctacggcccgcgcgggctggtggtgctggccgtg
ccctcggacgatttcaatcaggaactggccgatgaggccgcggtgaaggatttctgcgag
gtcaatttcggactgacgctgccgatgaccgagatcacccatgtgaagggggccgaggcg
catccgttctatcgctggatggctgaagagcacgatttcaagccgggctggaatttcaac
aaggtccttctcgatggttccgggaatccggttgccacattcggcgctttcaccaagccg
caatcggcgaagctgacctcgaaaatcgaaacccttctgtcgcaataa

DBGET integrated database retrieval system