KEGG   Rhodovulum sp. MB263: B5V46_11965Help
Entry
B5V46_11965       CDS       T04771                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm00071  Fatty acid degradation
rhm00072  Synthesis and degradation of ketone bodies
rhm00280  Valine, leucine and isoleucine degradation
rhm00310  Lysine degradation
rhm00362  Benzoate degradation
rhm00380  Tryptophan metabolism
rhm00620  Pyruvate metabolism
rhm00630  Glyoxylate and dicarboxylate metabolism
rhm00640  Propanoate metabolism
rhm00650  Butanoate metabolism
rhm00900  Terpenoid backbone biosynthesis
rhm01100  Metabolic pathways
rhm01110  Biosynthesis of secondary metabolites
rhm01120  Microbial metabolism in diverse environments
rhm01130  Biosynthesis of antibiotics
rhm01200  Carbon metabolism
rhm01212  Fatty acid metabolism
rhm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5V46_11965
   00630 Glyoxylate and dicarboxylate metabolism
    B5V46_11965
   00640 Propanoate metabolism
    B5V46_11965
   00650 Butanoate metabolism
    B5V46_11965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5V46_11965
   00072 Synthesis and degradation of ketone bodies
    B5V46_11965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5V46_11965
   00310 Lysine degradation
    B5V46_11965
   00380 Tryptophan metabolism
    B5V46_11965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B5V46_11965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5V46_11965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5V46_11965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhm04147]
    B5V46_11965
Enzymes [BR:rhm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B5V46_11965
Exosome [BR:rhm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5V46_11965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARC89273
UniProt: A0A1V0HZA9
Position
2561413..2562588
Genome map
AA seq 391 aa AA seqDB search
MTNVVIVSAARTAVGSFNGAFATVPAHELGRTMLEALVARAGIDKADISETILGQVLTAG
QGQNPARQAHINAGFPVESAAWSINQVCGSGLRSVALAAQHIQLGDAAIIAAGGQENMTL
SPHVAHLRAGHKMGDVKFIDSMIRDGLWDAFNGYHMGQTAENVAEQWQISREMQDEFALA
SQNKAEAAQKDGKFADEIVPVTVKGRKGDTIVEADEYIRHGATLESMQKLRPAFAKDGSV
TAGNASGINDGAAGVLLMSADEAERRGLEPLARIASYATAGLDPSIMGTGPIPASRKALE
KAGWKVGDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGARILNTL
LFEMKRRDAKKGLATLCIGGGMGVAMCLERA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtcgtcatcgtttccgccgcccggaccgcggtcggcagcttcaacggcgca
ttcgcgaccgttccggctcatgaactcggccggacgatgctcgaagcgctcgtcgcgcgc
gcgggcatcgacaaagccgacatctcggagaccattctcggccaggtgctgacagcgggt
cagggtcagaacccggcccgtcaggcccatatcaatgccggcttcccggtcgaatccgcc
gcctggtcgatcaaccaggtctgtggttcgggcctgcgctcggtcgcgctggccgcgcag
catatccagctgggcgacgctgccatcatcgccgccggcggtcaggagaacatgacgctc
agcccccatgtcgcgcatctgcgcgcgggtcacaagatgggcgacgtcaagttcatcgac
tcgatgatccgggacgggctctgggatgccttcaacggctatcacatgggccagaccgcc
gagaacgtggcggaacaatggcagatcagccgcgagatgcaggacgaattcgccctggcg
agccagaacaaggccgaagcggcgcagaaagacggcaagttcgccgacgagatcgtgccg
gtgacggtcaagggccgcaagggcgacaccatcgtcgaagccgacgaatatatccgccac
ggcgccacgctcgaatcgatgcagaagctgcgcccggccttcgccaaggacggctcggtc
accgcgggcaatgcgagcggcatcaatgacggcgccgccggtgtgctcttgatgtcggct
gacgaggccgagaggcgcgggctcgagccgctggcgcggatcgcctcctacgccaccgcc
gggctcgatccgtcgatcatgggtacgggcccgatcccggcctcgcgcaaggcgctggaa
aaggccggctggaaggtcggggatctcgacctggtcgaagccaacgaggccttcgccgcc
caggcctgcgccgtcaacaaggacatgggttgggatccggccatcgtcaacgtgaacggc
ggcgcgatcgccatcggccacccgatcggcgcctcgggcgcgcgcatcctcaacaccctg
ctcttcgagatgaagcgccgggacgccaagaagggccttgccaccctttgcatcggcggc
ggcatgggcgttgccatgtgcctggaacgcgcctga

DBGET integrated database retrieval system