KEGG   Rhodovulum sp. MB263: B5V46_12245Help
Entry
B5V46_12245       CDS       T04771                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rhm  Rhodovulum sp. MB263
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rhm03009]
    B5V46_12245
Enzymes [BR:rhm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     B5V46_12245
Ribosome biogenesis [BR:rhm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B5V46_12245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ARC89323
UniProt: A0A1V0HZG4
Position
2616008..2617048
Genome map
AA seq 346 aa AA seqDB search
MSTPLSSPRRLAVIIGPAPPGRLDKALARDVPEQAGLTRSRLAKLIAAGAVRRNGMALTD
ARAKVAEGEQLEIELAEPVETETLAEDIPLSVVYEDDALIVIDKPAGLVVHPAPGSPSGT
LVNALLAHCGASLAGIGGERRPGIVHRIDKETSGLLVAAKTDKAHAALAAQFAAHTVERQ
YSALVHGLPDASDPRLRGIAGTSFEPGGVLRIATRIGRHRTDRQRQAVLAAGGRHAVTRV
RVISPFGTPPAAALVSCWLETGRTHQIRVHMAHAGHGLIGDPVYGGRRRLSEKALGREAA
AAAAAFPRQALHAATLGFVHPETGETLRFAAPLPADMQELVRSLER
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgccgctctcctcgcctcgtcgcctcgccgtcatcatcggcccggccccgccc
ggccgccttgataaggcgcttgcccgcgatgtgccagagcaggccgggctgacccgctcg
cgcctggccaagctgatcgccgcgggcgcggtccggcgaaacggcatggcgctgaccgat
gcccgggcgaaggtggccgagggcgagcagctcgagatcgagctggccgagcccgtcgag
accgagacccttgccgaggacatcccgctgagcgtggtctacgaggacgacgcgctgatc
gtgatcgacaagcctgcggggcttgtggtccatccggcgccgggcagcccctcgggcacg
ctggtcaacgcgctgctggcccattgcggcgcaagcctcgcgggcatcggcggcgagcgg
cggccgggcatcgtgcaccggatcgacaaggagaccagcggccttctggtcgcggccaag
accgacaaggcccatgccgccctcgccgcgcaattcgcggcccataccgtcgagcggcaa
tacagcgccctcgtccatggcctgcccgacgcctcggacccgcgcctgaggggcatcgcc
gggaccagcttcgagcccggcggggtgctgcggatcgccacccggatcgggcgccaccgc
accgaccggcagcgccaggcggtgctggccgcgggcgggcgtcatgcggtgacccgggtc
cgggtgatcagccccttcggcacgcccccggcggcggcgctggtctcctgctggctggaa
accggacgcacccaccagatccgggtccatatggcccatgccgggcacgggctgatcggc
gatccggtctatggcgggcggcggcggctttcggaaaaggccctgggacgcgaggcggcg
gccgctgccgccgctttcccgcggcaggcgctccatgccgcgacgctgggcttcgtgcat
cccgagaccggcgagaccctgcgctttgccgccccgctgcccgccgacatgcaggaactg
gtccggagcctcgaacgttga

DBGET integrated database retrieval system