KEGG   Rhizobium sp. N1341: AMJ98_CH02623Help
Entry
AMJ98_CH02623     CDS       T04420                                 

Definition
(GenBank) glucose 1-dehydrogenase protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00030  Pentose phosphate pathway
rhn01100  Metabolic pathways
rhn01120  Microbial metabolism in diverse environments
rhn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMJ98_CH02623
Enzymes [BR:rhn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     AMJ98_CH02623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ANL10279
Position
2632780..2633562
Genome map
AA seq 260 aa AA seqDB search
MDLGLTNKRVLVTGGNSGLGAAISRACAAEEARVAINYLINTKEAQRLAKEFTAAGGEAL
CLMADISDPKAVKTMFTAIDDAWGGIDILINNAGIDGGYALGWEADPDAWGRVVDINLKG
TYLCARQALKRMVVQRSGVVLNTTSVHEVIAWTGYSAYAASKAAVSMMSKSLAQEAAPHG
VRVLCIAPGAIRTPINQAVWQDAEGYRDLLTKIPLGRIGEPEDVANIAVMLASDAAGYMT
ATTVFVDGGMTDYPSFAHGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacctcggactgacgaacaaacgcgttctcgtgacgggaggcaattctggtctcgga
gccgcgatttcgagggcctgtgccgccgaggaggcacgagttgcaatcaactatctgata
aataccaaagaagcccagaggctcgctaaggaattcactgctgccggtggcgaggctctt
tgtctgatggcggacatcagcgaccctaaagcggtcaagacgatgttcactgcgatcgac
gatgcctggggcggcatcgacatattgatcaacaacgccggaattgacggcggatatgcg
ctcggctgggaagctgatccggatgcctggggcagggtagtcgacatcaacctgaaggga
acatatctgtgcgcgcgccaagctctgaaacgcatggtcgtccagcggtcgggtgtcgtg
ctcaacaccaccagcgttcatgaggtaatcgcctggactggctacagtgcctatgctgct
agcaaggcggccgtgtcaatgatgtccaagtcgctggcacaggaggcggcgccgcatggc
gttcgcgttctttgcattgcgccgggagcgatccgcaccccgatcaatcaggcggtttgg
caggatgcggagggctaccgtgatttgctgacgaagattcccctcggccgcattggcgag
cccgaagacgtcgcaaacatcgcggtcatgctggcgtcagatgccgcgggctatatgacc
gcgacgacggtcttcgtcgatggaggcatgacagattatccctcctttgcgcacggcggg
tga

DBGET integrated database retrieval system