KEGG   Rhizobium sp. N1341: AMJ98_CH04008Help
Entry
AMJ98_CH04008     CDS       T04420                                 

Gene name
gluQ
Definition
(GenBank) glutamyl-Q tRNA(Asp) synthetase
  KO
K01894  glutamyl-Q tRNA(Asp) synthetase [EC:6.1.1.-]
Organism
rhn  Rhizobium sp. N1341
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhn01007]
    AMJ98_CH04008 (gluQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rhn03016]
    AMJ98_CH04008 (gluQ)
Enzymes [BR:rhn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.-  
     AMJ98_CH04008 (gluQ)
Amino acid related enzymes [BR:rhn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   AMJ98_CH04008 (gluQ)
Transfer RNA biogenesis [BR:rhn03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AMJ98_CH04008 (gluQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ANL11603
Position
4101109..4101990
Genome map
AA seq 293 aa AA seqDB search
MTTSERQKPVFRFAPSPNGSLHLGHALSAFLNRDMAEAENGRLLLRIEDIDQTRCTPRFE
AGILRDLDWLAIDWESPVRRQSEHFPEYQAALHALIERGLVYPAFLTRGEVKACVSAYEV
TGQSWPRDPDGTPHYPPIDRERSEAEWRDILSSGKKHAWRLDMRKALDLIGELLFWTETG
DGRTGEIAAEPDVWGDVILSRSDAPSSYHLSVVVDDALQGVTHVVRGLDLFHATSVHRLL
QVLLGLPQPLYHHHRLILDTDGRKLSKSEGDSGLAELRAQGMSGADIRRLVGL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagcgagcgtcaaaaacctgtctttcgttttgcgccgagtcccaacggatcg
ctgcatctcggccatgcactgtcggcctttttgaaccgcgacatggccgaagccgaaaat
ggccgccttctgctgcgcatcgaggatatcgatcagacgcgctgcacccccagattcgag
gccggcatcctgagggatctcgactggcttgctatcgactgggaaagcccggtgcggcgc
cagtcggaacatttcccggaatatcaggcggcgctccacgcattgatcgagcgcggcctg
gtctacccggccttcttgacacgcggcgaggtgaaggcgtgtgtctccgcctacgaggta
acgggccagtcctggccgcgcgaccccgatggcacgccgcattatccgccgattgatcgc
gagcggtccgaggccgaatggcgggatattctttcttcgggcaaaaaacatgcctggcgg
ctcgatatgcgcaaggcgctcgacctgatcggcgaactgctgttctggaccgaaaccggc
gacggcaggacaggcgagatcgccgccgaacccgacgtctggggcgacgtcatcctgtct
cgctcggatgccccctcgagctatcatctttcggtggtcgtcgacgatgcgctgcagggc
gtcactcatgtcgtacgcgggctcgacctcttccacgctacatcggtgcaccggctgctg
caggtgctgctcggcctgccgcagcccctctatcaccaccatcgtctcattctcgatacc
gatggccgcaagctttcgaaaagcgaaggtgacagcggccttgccgaattgcgtgcccag
ggcatgtcaggggccgatattcgccgcctcgtcgggctctga

DBGET integrated database retrieval system