KEGG   Rhizobium sp. N1341: AMJ98_PE00017Help
Entry
AMJ98_PE00017     CDS       T04420                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00071  Fatty acid degradation
rhn00072  Synthesis and degradation of ketone bodies
rhn00280  Valine, leucine and isoleucine degradation
rhn00310  Lysine degradation
rhn00362  Benzoate degradation
rhn00380  Tryptophan metabolism
rhn00620  Pyruvate metabolism
rhn00630  Glyoxylate and dicarboxylate metabolism
rhn00640  Propanoate metabolism
rhn00650  Butanoate metabolism
rhn00900  Terpenoid backbone biosynthesis
rhn01100  Metabolic pathways
rhn01110  Biosynthesis of secondary metabolites
rhn01120  Microbial metabolism in diverse environments
rhn01130  Biosynthesis of antibiotics
rhn01200  Carbon metabolism
rhn01212  Fatty acid metabolism
rhn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMJ98_PE00017 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    AMJ98_PE00017 (vraB)
   00640 Propanoate metabolism
    AMJ98_PE00017 (vraB)
   00650 Butanoate metabolism
    AMJ98_PE00017 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMJ98_PE00017 (vraB)
   00072 Synthesis and degradation of ketone bodies
    AMJ98_PE00017 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMJ98_PE00017 (vraB)
   00310 Lysine degradation
    AMJ98_PE00017 (vraB)
   00380 Tryptophan metabolism
    AMJ98_PE00017 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMJ98_PE00017 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMJ98_PE00017 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMJ98_PE00017 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhn04147]
    AMJ98_PE00017 (vraB)
Enzymes [BR:rhn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMJ98_PE00017 (vraB)
Exosome [BR:rhn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMJ98_PE00017 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ANL13242
Position
pRspN1341e:15065..16264
Genome map
AA seq 399 aa AA seqDB search
MSYAYQPDEDWQPVVVAAYRTPIGRAFGSLSTVAAEDLLAPIIRRIVAETGVAPDAIDDV
LVGNAAGGGGNVGRLAALNAGLPMAVPGVAIDRQCGSGLEAIILAARLIQAKAGACFLAG
GVESVSTAPWRVERPKANGALPRFYGRARFSPETIGDPEMGVAAENVARQFGISRQRQDE
FALRSHRLAVKTAEAGLFRPEIVEIATAGGLVERDECPRPTTSLEALANLKPVFLADGSV
TAGNACPVNDGACLVLVMSRGMARSLGIEKGLAFIDSAAAGVDPNLLGIGPVASTGKLLQ
RQPHLLLSKIDAIEFNEAFAAQVLASLDQLDISADAVNKEGGAMALGHPFGASGAILVTR
LYSQLIRRDGRRPAATGLAMIGIGGGIGLTALFEAVRLF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctacgcctatcagcctgacgaggattggcagccggtcgtggtcgccgcctaccgc
acgccgatcggccgggccttcggctctctttcgacggttgcggccgaagatctgcttgcc
ccgatcattcgccggatcgtcgcggaaactggcgttgcgcccgatgccatcgacgacgtg
ttggtcggcaatgccgccggcggcggcggcaatgtcggccggctggcggcgctcaacgcc
ggcctgccgatggccgtccccggtgtcgccatcgatcggcaatgcggttccggcctagaa
gcgatcatcctggccgcccggctgattcaggcgaaggcgggtgcctgtttcctcgccggc
ggcgtcgaaagcgtcagcaccgccccatggcgcgtcgaaaggccgaaagccaatggcgcc
ctgccgcgcttttacggacgcgcgcgcttctcccccgaaacgatcggcgatcccgagatg
ggcgtcgccgccgaaaatgtcgctcgtcaattcggcatctcgcgccagcggcaggatgaa
ttcgccctgcgtagccaccgactggccgtcaagacggccgaggccggcctcttccggccg
gagatcgtcgagatcgccaccgccggcggtttggtggagcgggacgaatgtccgcgcccg
actacctcgcttgaggccctcgcaaacctgaagccggtcttcctcgccgatggctccgtg
acagcaggcaatgcttgccctgtgaatgacggcgcctgcctggtgctcgtcatgagccgc
ggcatggccagaagcctcggcatcgaaaaaggcctcgccttcatcgacagcgccgccgct
ggcgtcgatcccaacctgctcggcatcggtccggtcgcctcgacgggtaagcttctgcag
cgccagccccacctcttgctctcgaagatcgacgccatcgaattcaatgaggctttcgcg
gcgcaggttctggcgtcgctcgatcagctggatatatcagccgacgcggtcaacaaggag
ggcggcgccatggcgctcggccatcccttcggcgcctccggcgcgatcctggtcacccgg
ctctacagccagctcatccgcagggatggccggaggcccgccgccaccggcctcgccatg
atcggcatcggtggcggcatcgggctcacggcgcttttcgaggccgtccgccttttctga

DBGET integrated database retrieval system