KEGG   Roseburia hominis: RHOM_02765Help
Entry
RHOM_02765        CDS       T01621                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rho  Roseburia hominis
Pathway
rho00071  Fatty acid degradation
rho00280  Valine, leucine and isoleucine degradation
rho00310  Lysine degradation
rho00362  Benzoate degradation
rho00620  Pyruvate metabolism
rho00630  Glyoxylate and dicarboxylate metabolism
rho00640  Propanoate metabolism
rho00650  Butanoate metabolism
rho00900  Terpenoid backbone biosynthesis
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01130  Biosynthesis of antibiotics
rho01200  Carbon metabolism
rho01212  Fatty acid metabolism
rho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHOM_02765
   00630 Glyoxylate and dicarboxylate metabolism
    RHOM_02765
   00640 Propanoate metabolism
    RHOM_02765
   00650 Butanoate metabolism
    RHOM_02765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHOM_02765
   00072 Synthesis and degradation of ketone bodies
    RHOM_02765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHOM_02765
   00310 Lysine degradation
    RHOM_02765
   00380 Tryptophan metabolism
    RHOM_02765
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHOM_02765
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHOM_02765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHOM_02765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rho04147]
    RHOM_02765
Enzymes [BR:rho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHOM_02765
Exosome [BR:rho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHOM_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF1153
Motif
Other DBs
NCBI-ProteinID: AEN95675
UniProt: G2T031
Position
600506..601690
Genome map
AA seq 394 aa AA seqDB search
MAKKVVLAGACRTAIGKMGGALSNTPAAELGSIVIKEALNRAGVKPEQVDEVLMGCVIQA
AQGQNVARQASIKAGLPIEVPAVTLNVVCGSGLKCVNEAATMILAGQADIVVAGGMENMS
MAPYAMTKARFGYRMNNATIIDTMVNDALTDAFNHYHMMITAENVCEKYGLTREELDEFS
ANSQQKCEKAIAEGKFDDEIVPVPVKVKKETVMFAKDEGPRPGTTAESLSKLKCCSGKEG
GLVTAGNASGINDGAAAIVVMSEEKAKELGVKPMATWVAGALGGVEPEIMGVGPVASTRK
VLERTGLTIDDMDLIEANEAFAAQSVAVARDLKFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMQKRDAKRGLATLCIGGGMGCSTIVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagtagttttagcaggcgcatgccgtaccgctatcggcaagatgggtgga
gcactgagcaatactccggcagcggagctgggatcaatcgtaatcaaagaggcattgaac
agagctggcgtaaagccggagcaggtagatgaagtattgatgggatgtgttatccaggca
gcacagggacagaacgttgcacgtcaggcttccatcaaggcaggacttccgatcgaagta
ccggcagttactctgaacgttgtatgtggttccggactgaaatgtgtcaatgaagcagct
actatgattctggctggtcaggcagatatcgttgttgcaggtggtatggagaacatgtcc
atggctccttatgccatgacgaaggctcgttttggatatcgtatgaacaatgcgaccatc
attgataccatggtaaacgatgcactcaccgatgcattcaaccactatcacatgatgatc
acagctgagaacgtatgtgagaagtatggtcttacaagagaagaactcgatgagttctcc
gcaaacagccagcagaagtgcgagaaggcaatcgctgagggcaagttcgatgacgagatc
gttccggttccggttaaggttaagaaagagaccgttatgttcgcaaaagatgagggaccg
cgtcctggcacaacagctgagtcactgtccaagttaaaatgttgctccggcaaagagggc
ggactggtaaccgcaggtaacgcttccggtattaacgatggtgcagctgcaatcgttgtt
atgagcgaggagaaggcaaaagagcttggcgttaagccgatggcaacatgggtagccgga
gcactcggcggagtagagcctgagatcatgggtgtcggacctgttgcatctaccagaaag
gtacttgagagaacaggacttaccatcgatgatatggatctgatcgaggcaaacgaggca
ttcgcagcacagtctgttgcagttgcaagagatctgaagtttgatatgtccaaggtaaac
gtaaacggcggtgcaatcgcacttggtcacccggtaggagcttccggatgccgtatcctt
gttaccttattacatgagatgcagaagagagacgcaaagagaggtcttgctactctgtgc
atcggtggtggtatgggatgctctaccatcgttgagagagactaa

DBGET integrated database retrieval system