KEGG   Roseburia hominis: RHOM_02775Help
Entry
RHOM_02775        CDS       T01621                                 

Definition
(GenBank) butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
rho  Roseburia hominis
Pathway
rho00071  Fatty acid degradation
rho00280  Valine, leucine and isoleucine degradation
rho00410  beta-Alanine metabolism
rho00640  Propanoate metabolism
rho00650  Butanoate metabolism
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01130  Biosynthesis of antibiotics
rho01200  Carbon metabolism
rho01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RHOM_02775
   00650 Butanoate metabolism
    RHOM_02775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHOM_02775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHOM_02775
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHOM_02775
Enzymes [BR:rho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     RHOM_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AEN95677
UniProt: G2T033
Position
602746..603900
Genome map
AA seq 384 aa AA seqDB search
MDFTLDKKHEMARSLFREFAENEVKPLAQEVDETEEFPVENVKKMQKLGFMGIPVPKEYG
GQGCDPLTYVMCVEELSKVCATTGVIVSAHTSLCIDPIMTYGTEDQKQKYVKPLATGEKL
GAFALTEPGAGTDAQGAQTKAVLDGDEWVLNGSKCFITNGKVADVYIVIAITSVTEDKRG
RKKKNFSAFIVDKGAPGFSFGTKEKKMGIRGSSTYELIFEDCRIPKENLLGVEGKGFPIA
MHTLDGGRIGIAAQALGIAEGALDRAIAYTKERKQFGRTIAQQQNTQFKLADMAARIEAA
QLLVYKAAMAKATQKVYSVEAAKAKLFAAETAMAVTTEVVQLFGGYGYIREYDVERMMRD
AKITEIYEGTSEVQRMVISGALLK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatttcactttagacaagaaacatgaaatggcgcgctccctgttcagagagttcgct
gagaacgaggtaaagcctctcgctcaggaagtagatgagacagaggaattcccggttgag
aacgtgaagaagatgcagaagctcggcttcatgggcatcccggtaccgaaggagtacggc
ggacagggctgtgacccgctcacctatgtaatgtgcgtagaggagctgtccaaggtatgc
gctacaacaggtgttattgtttctgcacatacttctctctgcattgatccgattatgacc
tacggtacagaggatcagaagcagaaatacgttaagccgcttgcaacaggcgagaagctc
ggtgcattcgcactgactgagccgggtgcaggaaccgatgcgcagggcgcacagaccaag
gctgtattagacggagacgagtgggtattaaacggctccaagtgcttcatcacaaatggt
aaggttgcagatgtttatatcgtaatcgcaatcacaagcgtaacagaggataagagaggc
agaaagaagaagaacttctctgcatttatcgtagataagggagctccgggcttctccttc
ggaaccaaggagaagaagatgggtatccgcggatcatctacatacgagctgatcttcgag
gattgcagaatcccgaaggagaacctgcttggcgtagagggcaagggattcccgatcgct
atgcacacactggatggcggacgtatcggtattgctgctcaggcacttggtatcgcagag
ggcgcattagaccgcgcaatcgcatacaccaaggagagaaaacagttcggccgtacgatt
gcccagcagcagaatacacagttcaagctggctgacatggctgcaagaattgaggctgca
cagcttcttgtatacaaagctgctatggcaaaggcaacacagaaggtatattctgtagag
gctgcaaaggcaaaactgttcgcagcagagactgctatggctgttaccacagaggttgtc
cagctgtttggtggatacggttacatcagagagtacgatgtagagcgtatgatgcgtgac
gcaaagatcacagagatctacgagggaaccagtgaggttcagagaatggttatctctggt
gcattactgaaatag

DBGET integrated database retrieval system