KEGG   Roseburia hominis: RHOM_03560Help
Entry
RHOM_03560        CDS       T01621                                 

Definition
(GenBank) ABC transporter
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
rho  Roseburia hominis
Pathway
rho02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rho00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RHOM_03560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rho02000]
    RHOM_03560
Enzymes [BR:rho01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     RHOM_03560
Transporters [BR:rho02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    RHOM_03560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_23 SbcCD_C AAA_16 AAA_22 MMR_HSR1 AAA_15 AAA_30 AAA_24 AAA_25
Motif
Other DBs
NCBI-ProteinID: AEN95834
UniProt: G2T249
Position
775389..776909
Genome map
AA seq 506 aa AA seqDB search
MEHNVVLTMRGITMTFPGVKALDNVDLTLRKGEIMALMGENGAGKSTLIKCLTGINAFDA
GEIRVDGIDEPVVNHSTLDAQKKGISTVYQEVNLCPNLSVAENLFIGREPKTKLGTIDWK
TMTAKSNRIIKSLDLDIDVTKNLEEYSLALQQMIAIARAVDMDCKVLILDEPTSSLDDHE
VEKLFVLMRQLKEKGVAIVFVTHFLEQVYAVCDRITVLRNGILVGEYPIEELPRVKLVAA
MMGKDFDDLAAVKSEEKKDFTNVPVVIDAQGMSHKGKIKPFDLQIHKGEVVGLTGLLGSG
RSELARVIYGADKNQTGKLFVNGKEAKINAPIDAMNLGMGLLPDDRKAEGIIADLSVREN
IILAMQAKRGMFKLLPMSRQNEIADKYIELLQIKTASRETLIGQLSGGNQQKVILARWLA
TDPEFLILDEPTRGIDVGTKTEIQKLVIELADQGKSLIFISSEIEEMLRTCSKLVVLRDG
QEVGEITEELTQGHVMQSIAGGGRNE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggagcataatgtggtactgaccatgcgggggattaccatgacatttccgggcgtaaag
gcactggacaatgtggatcttacactgcggaagggcgagatcatggcactgatgggagaa
aatggtgccgggaaatctacactgatcaagtgtctgaccggaatcaacgcgttcgatgcg
ggagaaatacgcgttgacgggatcgatgaaccggtggtcaatcattcgaccctggatgca
cagaaaaagggcatatccacggtgtatcaggaagtcaatctttgcccgaatttgagtgtg
gcagaaaatttatttatcggcagggagccgaagacaaagcttggaaccatcgactggaag
acgatgacagcaaaatccaacaggattattaagagcctggatcttgatattgacgtaacc
aaaaatctggaagagtattcactggcgctccagcagatgattgcgattgcaagagcggtg
gatatggattgtaaggtactgattttagacgagccgacatcctccctggatgaccatgag
gttgaaaagctgttcgttcttatgcggcagctgaaggaaaagggtgtggcgattgtgttt
gtgacacactttctggagcaggtatacgcagtctgtgaccggatcacagtgctccggaac
ggcatactggtcggagaatatccgattgaggagctgccaagggtaaagctggttgcagcg
atgatgggcaaggattttgatgaccttgcagctgtaaaatcagaagagaagaaggatttc
accaatgtgccggtggttatcgatgcgcagggcatgagccacaagggaaagatcaagccg
tttgatttacagatacataagggtgaggtcgtgggactgacaggtctgcttggctcggga
cgcagtgagctggcgcgtgtcatctatggagcggataaaaaccagacaggtaagctgttt
gtcaacggaaaagaggcaaagatcaatgcgccgattgatgcgatgaatcttggaatggga
cttcttccggacgacagaaaggcagagggcattatcgcagacttatctgtacgagaaaat
ataattctggcaatgcaggcaaagcgcggaatgtttaagctgcttccaatgagcagacag
aacgagatcgcagacaagtatatcgagctgctgcagatcaagacggcgagcagggagacc
ctgatcgggcagctctccggcggaaaccagcagaaggtgattctggcacgctggcttgcc
acagatccggaattccttattctggatgagccgaccagaggtatcgatgtcgggacaaag
actgagatccagaagcttgtgatcgagcttgcggatcagggaaagagtctgatcttcatc
tcttccgagattgaggagatgctcagaacatgctccaagctggtggtattaagggatggt
caggaagtgggagagatcactgaggaactgacccaggggcatgtaatgcagtccatagca
ggaggtggcaggaatgagtaa

DBGET integrated database retrieval system