KEGG   Roseburia hominis: RHOM_03780Help
Entry
RHOM_03780        CDS       T01621                                 

Definition
(GenBank) glycoside hydrolase family 3 protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rho  Roseburia hominis
Pathway
rho00520  Amino sugar and nucleotide sugar metabolism
rho01100  Metabolic pathways
rho01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHOM_03780
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RHOM_03780
Enzymes [BR:rho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHOM_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEN95878
UniProt: G2T083
Position
819828..821615
Genome map
AA seq 595 aa AA seqDB search
MVDMKAKPFYLSDEDCKWVEETIAGMTTEEKIGQLFFNMGSSRDEEYLKMTVDKYHIGGI
RYNPATGAEVREQNRILQENSKIPLIIACNTENGGNGACTDGTMIGQQTKIGATRDARYA
YELGRMSNKEAAAIGCNLSFAPVSDILYNWENPVIGLRTYGNDVDRVCEMTKAYMDGAHT
NEGFCCAAKHFPGDGLDFRDQHVADSVNDMSCEEWDASYGKVYQNLIDNGLEAIMAGHIM
QPAYTRHFNPGIRDEDIMPATLSPELIEGLLRGKLGFNGMVLTDASHMVGLTCCMKRSEM
LPHTIAAGVDMFLFFNEMDEDFASMMAGYENGIITEERLNDALHRILALKAHMGLHKKAK
NEIVPPVEVMEQVVGCEEHKAMAREISEKGITLVKYKDEDVLPMIPSRYKRIMIVSVSGL
SAGVMGTMMAKYMGGGKKSPAERLRDKLIEKGFEAFIYESPLDALAKRAAAGEKVDINMY
FAGKTPIKDFVENQDLIITLVDIAGGFQPVARPGFGMSKGGGEIPWYVHELPVIVIGCGQ
PFVLADIPQARTYINTYDSADQTFDALIEKLMSGSDAFIGEDPVDAYCGLWDTHR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtagatatgaaggcaaaaccgttttacctgtccgatgaggactgtaaatgggtggaa
gagaccatcgcgggtatgacgaccgaggagaagatcggtcagctttttttcaatatggga
tcctccagagacgaagagtatctgaagatgacagtggacaagtaccacatcggcggtatc
cgctacaacccggcaaccggtgccgaggtgcgtgagcagaaccggattcttcaggagaac
agcaagattccgcttatcattgcgtgcaacacggagaatggcggcaacggcgcctgcact
gacggaaccatgatcggccagcagaccaagatcggtgcgacaagagacgccagatacgcg
tacgagctcggccgtatgtccaacaaagaggcggcggcgatcgggtgtaatctctccttt
gccccggtcagcgacatcctctacaactgggagaacccggtcatcggactgcgcacctat
ggaaacgatgtggaccgcgtgtgcgagatgacgaaggcatatatggacggcgcacacacc
aatgagggattctgctgtgctgcgaagcattttccgggcgacggactggacttccgcgac
cagcacgtggcagacagcgtcaatgacatgagctgtgaggagtgggatgcaagctatgga
aaagtataccagaacctcattgacaacggtctggaagccatcatggcaggacacattatg
cagcctgcgtacaccagacattttaacccgggaatcagggatgaggacatcatgccggca
accctttcgccggagctgatcgagggacttctgcgcggaaagcttggttttaatggtatg
gtgctgaccgatgcttcccacatggtcggactgacctgctgtatgaagcgcagcgagatg
cttccgcacacgattgcagccggtgtcgatatgttcctttttttcaatgagatggatgag
gattttgcaagcatgatggcgggctatgagaacggcatcatcaccgaggagcgtttaaat
gacgccctgcaccgcattcttgctctgaaagcacacatgggactgcacaaaaaagcgaaa
aatgagatcgttcctccggtggaggtgatggagcaggtcgttggctgcgaagagcacaag
gcgatggcaagagaaatctccgagaaaggaatcactctcgtaaaatacaaggacgaggat
gtgcttccgatgatcccgagccgttacaagcgcatcatgatcgtctccgtcagcggatta
tccgcgggcgtgatgggaaccatgatggcaaaatatatgggcggcggcaagaagagcccg
gcagagcgtctgcgtgacaagctgatcgagaagggctttgaagcatttatctacgagagc
ccgctcgacgcacttgcaaagcgtgcagcagcaggagaaaaggtggacatcaatatgtac
tttgccggaaagacgccgatcaaggatttcgtcgaaaatcaggatctgatcatcacactg
gtggacattgcaggcggtttccagccggtggcaagaccgggcttcggcatgagcaagggc
ggcggagagatcccgtggtatgttcatgaacttccggttatcgtgatcggatgcggacag
ccgttcgtactggcagacattccgcaggcgagaacgtatatcaacacttacgacagcgcg
gatcagacgtttgatgcgctcatcgagaagctgatgagcggcagcgacgcatttatcggg
gaggacccggtggatgcctactgcggactgtgggatacgcaccggtag

DBGET integrated database retrieval system