KEGG   Roseburia hominis: RHOM_06575Help
Entry
RHOM_06575        CDS       T01621                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rho  Roseburia hominis
Pathway
rho00260  Glycine, serine and threonine metabolism
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01130  Biosynthesis of antibiotics
rho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_06575
Enzymes [BR:rho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RHOM_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEN96432
UniProt: G2T2P9
Position
1449630..1450670
Genome map
AA seq 346 aa AA seqDB search
MIRFNSDYTEGCHPAILERLAATNMEQTPGYGEDVYCAAAAEQIKEACAAPEAAVHFLVG
GTQTNVTVISAALRHYQGVITAVTGHINVHETGALESCGHKCLTIETADGKLTAEQIAAY
TDAHYADASFEHTVQPKMVYISNPTEIGTIYKKAELEAIYDVCKERGLYLFLDGARLGYG
LTCRENDLTLADVAALTDVFYIGGTKVGALFGEAVVITNEELKRDFRYNMKQRGGMLAKG
RLLGIQFLTLFEEKRYFEISAHASRLAEKIHDELKDMGVKFYVDSPSNQQFVILPDAVLE
KLKDDFAFEYQARVDDTHSAVRICTCWATKEENVEALLAALRGLLR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatacggtttaacagtgattacacagagggatgccatccggcgatcttagagagactt
gcggcaaccaacatggaacagaccccgggatacggggaggatgtatattgtgcggcagct
gcggagcagataaaagaggcgtgcgccgcaccggaggcagcggtgcattttctggtggga
ggaacacagacgaatgtgacagtgatttcggctgcattaagacactatcagggtgtgatc
actgcggtgaccggacacatcaacgtacatgagacgggagcactggagtcctgcggacac
aagtgccttacgatcgagacggcggacggcaaactgacagcagaacagattgctgcatat
acggacgcgcattatgccgacgcaagttttgaacacacggttcagccgaagatggtctat
atttccaatccgacggagattggcacgatctataaaaaagcggagctggaggcgatctat
gatgtctgcaaagagagagggctttatctgtttttagacggtgcaagactgggctacggt
cttacatgccgggaaaatgatctgacacttgccgatgtggcggcgctcacggatgtcttc
tacatcggaggaaccaaggtcggagcgctctttggcgaggcggttgtgatcacaaacgag
gaattgaagcgcgatttccgttacaatatgaagcagcggggcggcatgctggcaaaaggc
agactgctcggcattcagttcctcacgctattcgaggagaaaaggtattttgagatctcg
gcgcatgcatcaaggcttgcggaaaagatccatgatgagctaaaggacatgggcgtaaaa
ttttatgtggactcgccgtcgaaccagcagtttgtgattcttccggatgcggtgcttgaa
aagttaaaagacgattttgcatttgaatatcaggcgcgtgtggacgatacgcatagcgct
gtccgcatctgtacctgctgggcaaccaaagaggaaaacgtggaggcgcttcttgctgca
ctgaggggattattacgatag

DBGET integrated database retrieval system