KEGG   Roseburia hominis: RHOM_07345Help
Entry
RHOM_07345        CDS       T01621                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rho  Roseburia hominis
Pathway
rho00230  Purine metabolism
rho01100  Metabolic pathways
Module
rho_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RHOM_07345
Enzymes [BR:rho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RHOM_07345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 ABC_tran AAA_30 AAA_29 cobW AAA_16 Methyltransf_12 RsgA_GTPase AAA_17 MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEN96582
UniProt: G2SWQ6
Position
1606516..1607151
Genome map
AA seq 211 aa AA seqDB search
MQKNKGILTVVSGFSGAGKGTIMKALMQAHSETYALSISATTRAPRTGERDGIEYFFKSR
EAFEQMIADDALVEYAEYVGNYYGTPKAYVEEQLARGKDVILEIEIQGALKVRRQFPDAL
LLFVTPPSAEVLKNRLIGRGTETMDVIEHRLARALEEAEGLEEYDYLVVNDVLEEAVREV
HEIIQNEHYRVARNADKIREMRNELKGFTRQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaataaaggaattttgacagtcgtatcggggttttccggtgcgggaaaaggt
acgatcatgaaggcgctcatgcaggcacacagcgagacctacgcgctctcgatttccgcg
acgacgcgcgcaccgcgaaccggggagcgcgacggtatcgagtattttttcaagagccgc
gaagcgtttgagcagatgatcgcggacgatgcgcttgtggaatatgcagagtatgtgggc
aactattacggcacaccgaaggcatatgtggaagagcagcttgccaggggcaaggacgtg
atcttggagattgagattcagggtgccttaaaggtacgcagacagtttccggatgcgctg
cttttgtttgtgactccgccgagcgcggaagtgttgaagaaccggctgatcggccgtgga
acagagaccatggacgtcattgaacaccggctggcacgcgcgttagaagaagccgaaggg
ctggaggaatacgactatctggtagtcaacgatgtgctggaggaagcggtcagggaagtg
catgagatcatccagaatgagcactaccgcgtagcgcgcaatgcagacaaaatccgtgaa
atgagaaacgagctgaaaggcttcacgcgtcagtaa

DBGET integrated database retrieval system