KEGG   Roseburia hominis: RHOM_11870Help
Entry
RHOM_11870        CDS       T01621                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
rho  Roseburia hominis
Pathway
rho00052  Galactose metabolism
rho00520  Amino sugar and nucleotide sugar metabolism
rho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    RHOM_11870
   00520 Amino sugar and nucleotide sugar metabolism
    RHOM_11870
Enzymes [BR:rho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     RHOM_11870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 DAO FAD_oxidored Amino_oxidase Pyr_redox_2 FAD_binding_2 Thi4 HI0933_like Pyr_redox GIDA NAD_binding_9 GDI FAD_binding_3 Shikimate_DH GMC_oxred_N AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEN97482
UniProt: G2T437
Position
complement(2584675..2585871)
Genome map
AA seq 398 aa AA seqDB search
MKQVNVKTMRAVPQNGGDMYDCIVIGAGIAGAVAARKLAEEKGKRVLVMERRPHIGGNCY
DEKDAHGILIHNYGPHIFHTGLEEVFAYLSRFTDWYLFGHEVVAKVGDQLIPVPFNLNTL
HMVYGKEKADRLEQKLIETYGEGSRVPIMKLRENEDADIREIAQYVYENVFLYYTMKQWG
QKPEEISPEVTGRVPVLISYDNRYFQDKYQGVPANGFTEMFEKMLSHPGITVECGTDCLS
RMRFADNEIYFDGEKFDGDVIYTGALDELFACRYGRLPYRSLDFRFEHYDGASYQGHSVV
NYTVSEDFTRITEFKFLTGQRDTDGTTIVKEYPFAYTGAEGEIPYYAILNEENQALYEKY
RALTAGMEHFHLLGRLAEYRYYNIDAMVKRAMELADRL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtcaatgttaagacaatgcgggcagtaccgcagaacggaggagacatgtac
gattgtattgtcattggagccggaattgccggagcggtggcagcgcgaaagctggcagag
gaaaaaggaaagcgtgtccttgtcatggaacgccgaccgcatatcgggggaaactgttac
gatgagaaagatgcccacggcattttaattcataattacggaccgcatatttttcacaca
ggtctggaggaagtgtttgcatatttatcgcgttttacggactggtacctgttcgggcac
gaggtggtcgcaaaggtcggggatcagctgattccggtgccgtttaacttaaatacgtta
catatggtatacgggaaggagaaagccgaccggctggagcaaaagctgatcgaaacctac
ggcgagggttcgcgtgtgccgatcatgaagctgcgcgagaacgaggatgcggatatccgc
gagattgcacagtatgtgtatgagaatgtatttttatattacacgatgaagcagtggggt
cagaagccggaggagatcagcccggaggtcacagggcgcgtcccggtgttaatctcctat
gataaccgctattttcaggataagtaccagggagtgccggcgaacggatttacagaaatg
tttgagaagatgctttcccatccggggatcacggtggagtgcggcacggactgcttaagc
cgcatgcgctttgcggacaatgagatttattttgacggcgaaaaattcgacggcgacgtg
atctacaccggcgcgctggatgaattgtttgcatgcaggtatggaagactgccgtaccgc
tcgctggatttccggtttgagcattacgacggggcgtcttaccagggacacagtgtggtc
aactacacggtgagcgaggattttacccgtatcacggaattcaagtttttgaccgggcag
agggatacggacggcaccacgatcgtgaaggagtatccgtttgcgtatacgggagcagag
ggagagattccgtactatgcgattttgaatgaggaaaatcaggcgctgtacgaaaaatac
cgggcactcacggctggcatggagcattttcatctgctcggacggctggcggagtaccgc
tattacaacatcgacgcgatggtgaagcgcgccatggaactggcagacagattgtaa

DBGET integrated database retrieval system