KEGG   Roseburia hominis: RHOM_12735Help
Entry
RHOM_12735        CDS       T01621                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rho  Roseburia hominis
Pathway
rho00471  D-Glutamine and D-glutamate metabolism
rho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RHOM_12735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rho01011]
    RHOM_12735
Enzymes [BR:rho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     RHOM_12735
Peptidoglycan biosynthesis and degradation proteins [BR:rho01011]
 Precursor biosynthesis
  Racemase
   RHOM_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEN97655
UniProt: G2SY67
Position
complement(2773233..2774045)
Genome map
AA seq 270 aa AA seqDB search
MEKYENRQECPIGVFDSGVGGISVLRELVAQMPNENYIFFGDSKNAPYGTKTLEEVQKLT
CADAEYLLSRGVKALVVACNTATSAAIRILREKYADMPVIGIEPALKPAVHAGGHPRVLV
MATPMTLREEKFHALMQRFESDAEILRLPCPGLVEYVEQGVLEGAELEAFLANLFEPYQS
HPVDCVVLGCTHYPFVRETIQKLLGAGVQIFDGGAGTARETERRLKDCGLCSGRAQQGTV
ELCNSLASEQMKQLEIRLLQSGTVQAIIKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagtatgaaaacagacaggaatgtccgattggtgtgtttgattcgggagtcgga
ggaatcagtgtgctgcgggaactggtggcacagatgccgaacgagaattatatctttttt
ggggattctaagaatgcgccctacggtacaaagacgctggaggaagtgcagaagctgacc
tgtgcggatgccgaatatctgctgtcacgcggcgtaaaggcgctcgtggtggcatgcaac
acggcgacaagcgcggccatccggatccttcgggaaaaatatgcggatatgccggtaatc
ggaatcgagccggcattaaagccagcagtgcacgcgggcggacacccgcgtgttctggtc
atggcaacaccgatgaccctgcgcgaggagaagtttcacgccctgatgcagcggtttgag
tcggatgccgagattctccggctgccgtgtccggggctggtggagtatgtggagcagggc
gtgctggagggcgcagaactcgaagcgtttcttgcaaatctgtttgaaccgtaccaaagc
catccggtggattgtgtcgtgcttggctgcacgcattatccgtttgtgcgggagacaatc
cagaagcttctcggagccggagtgcagatctttgacggcggagcggggaccgcgcgggag
acagaacgcaggcttaaggattgcggtctgtgcagtggcagagcgcagcaaggaaccgtg
gaattgtgcaacagtcttgcgtcggagcagatgaaacagctggagatccggctgctccag
tcgggcacggtgcaggcaattataaaaaaatag

DBGET integrated database retrieval system