KEGG   Roseburia hominis: RHOM_14590Help
Entry
RHOM_14590        CDS       T01621                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rho  Roseburia hominis
Pathway
rho03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rho00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RHOM_14590 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rho03011]
    RHOM_14590 (rplV)
Ribosome [BR:rho03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RHOM_14590 (rplV)
  Bacteria
    RHOM_14590 (rplV)
  Archaea
    RHOM_14590 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2423
Motif
Other DBs
NCBI-ProteinID: AEN98024
UniProt: G2T5M8
Position
complement(3138882..3139277)
Genome map
AA seq 131 aa AA seqDB search
MAKGHRSKIKRERNEVKDTRPSAKLSYARVSVQKACFVLDAIRGKDAQTALAIVSYNPRY
ASSVVKKLLESAIANAENNYPEKNYKLENLYVAECYANKGPTMKRIRPRAQGRAYRIEKR
MSHITIVLDEK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggctaagggacatagaagtaagatcaagagagagagaaatgaagtaaaagataccaga
ccatccgcaaagttatcttatgcaagagtgtctgttcagaaagcatgcttcgtattagac
gcaattcgtggaaaggacgctcagacagcattagctatcgtatcctacaatccgcgttac
gcttccagcgtggttaagaaactgttagagtcagcaatcgcaaatgctgagaacaattat
ccggagaagaattacaagttggagaacctgtatgttgcagagtgttatgcaaacaaggga
ccaacaatgaagagaatcagaccaagagcacagggcagagcttacagaatcgagaagaga
atgagccacattacaatcgtgctggatgagaaataa

DBGET integrated database retrieval system