KEGG   Rhodococcus sp. 008: AOT96_00330Help
Entry
AOT96_00330       CDS       T05462                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOT96_00330
Enzymes [BR:rhod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AOT96_00330
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AOT96_00330
    1.1.1.-  
     AOT96_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ANQ69481
Position
62925..63980
Genome map
AA seq 351 aa AA seqDB search
MKAARFHGQKDIRIEEIPEPELRPGTVKLKVAWCGICGTDLHEYLEGPIFISAPGHPHPL
SHENAPVTMGHEFSGTVEEVGEGVTDVEVGENVVVEPYFVCNECAPCKAGNYHLCTKMGF
IGLAGGGGGLSEKVVVDRRWIHKIGNIPLDEAALIEPLSVAHHAVVRSGAESGNVAIVGG
AGPIGLLVAAVLKGLGVTTIVTELSEARKAKALSSGVADYVIDPTTEDVKARVLELSGGI
GADIGFECAGVNAVLDTMLDTVRPAGVVVNVSIWGKPATIDMQKLVLKEIDLRGTIAYVR
DHEAVIKMVQDGVVDLAPFITGRIQLEELISEGFTTLIEHNDTAVKILVRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacggttccacgggcagaaagacatccggatcgaagagatccctgagccc
gaattgcggccaggaacagtcaagctgaaggtcgcatggtgcggaatctgcggcaccgat
ctccacgagtacctcgagggaccgatcttcatctccgcacccggacacccgcatcctctc
tcacacgagaatgcgccggtcacgatgggccacgagttctccggcaccgtcgaagaggtc
ggcgaaggtgtcacggacgtcgaggtcggcgaaaatgttgtcgtcgagccgtacttcgtc
tgcaacgagtgcgccccgtgcaaggcgggcaactaccacctgtgtacgaagatggggttc
atcggcttggctggcggaggtggcgggctcagcgagaaggtcgtcgtcgaccgtcgctgg
atccacaagatcggcaacatcccgctcgacgaggcagctctcatcgaaccgttgagcgtc
gcccatcacgccgtcgtacgcagtggagccgaaagcggcaacgtcgccatcgtgggcgga
gccggaccgattggactcctcgttgcggcagtcctcaagggtctgggtgtcacgacgatc
gtcaccgaactcagcgaagcccgcaaagccaaggccctctccagtggagtcgccgactac
gtcatcgatcccaccaccgaagacgtcaaagcgcgcgtcctcgaactcagcggaggcatc
ggcgcagacatcggcttcgaatgcgcaggcgtcaacgcggtcctcgacaccatgctcgac
acggtcaggcctgctggagttgttgtcaacgtgtcgatttggggcaaacccgcgactatc
gacatgcagaagctggtcctcaaggaaatcgacctacgcggaaccatcgcgtacgtacgc
gaccatgaagcggtcatcaagatggtccaggacggtgtcgtcgatctggcgccattcatc
accggtcgtattcagctcgaagaattgatctccgaaggattcaccactctgatcgagcac
aacgacactgcggtcaagattctcgtcaggtcgtga

DBGET integrated database retrieval system