KEGG   Rhodococcus sp. 008: AOT96_05170Help
Entry
AOT96_05170       CDS       T05462                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00020  Citrate cycle (TCA cycle)
rhod00310  Lysine degradation
rhod00380  Tryptophan metabolism
rhod01100  Metabolic pathways
rhod01110  Biosynthesis of secondary metabolites
rhod01120  Microbial metabolism in diverse environments
rhod01130  Biosynthesis of antibiotics
rhod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT96_05170
  09105 Amino acid metabolism
   00310 Lysine degradation
    AOT96_05170
   00380 Tryptophan metabolism
    AOT96_05170
Enzymes [BR:rhod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AOT96_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N TcdB_toxin_midN
Motif
Other DBs
NCBI-ProteinID: ANQ70315
Position
complement(1102927..1104240)
Genome map
AA seq 437 aa AA seqDB search
MLTLFDVHMPHMGSVEFALLTEWLLKPGDRVAEGDPLCEVSTDKVDTEVDSPTSGILISY
VAAVDQEVPVGDVIARFASLDADPVAVAQAIAGEDAVGEDVAPAAPTSGPIAGPFPISPD
RALESAAPTVAAEGSRPPNDSLVLAASWFSPVNRPPEGSRRLRLDSGSTDMSLESKSEFL
PGARDRVPEDADTVAIPAGYEAVTYTAIEHTRLRRAIAKNLTESWNTAPQLTAQVDVDFT
AVSVARAKINRERSARGEGKLSFLPFVGHALCRALADHPDANATFTDKHLVRWNTVNLGI
AVDTPDGLIVPVIRDAQNLELEALSDAIVATSSAILSGSAQPEDLSGGTITISNSGSVGG
VVSTPILTRPQVASIGLPAIVRTPVARKSVDGESELLTIRPIARLGLTFDHRAFDGAEAL
RTLMSVQKYLEQWPTKS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctcacactattcgacgtccacatgccccacatggggtcggtggaattcgcgttgctc
accgaatggctgctcaagcctggggacagggtcgccgagggcgatccgctttgtgaggtg
tcgactgacaaggtcgacaccgaagtcgactcgccaacttcgggaatcctcatcagctac
gttgccgcagtggatcaggaggttcctgtcggtgacgtcattgctcgatttgcctcactc
gacgccgacccggtagccgtcgcgcaagccattgccggtgaagatgcagtcggtgaagat
gtcgcgccggcggcgccgacatcgggtccgatcgcgggtccgttcccgatttcgccggat
cgggctctcgagagcgcggccccgacagtcgccgccgagggttctcgcccacccaacgat
tcactggtgttggctgcgtcgtggttctctccggtcaatcgtccgcccgaaggaagtcga
cgcctccgcctcgattcgggctcgactgatatgtcgctggagagcaagagcgaattcttg
ccgggagccagggatcgagtaccggaagatgctgacaccgtggcgattcccgccggatac
gaggcggtgacctacacggctatcgaacacactcgcctgcgtagggcaatcgccaagaat
ctgacagaatcgtggaatacggctcctcaattgacggcgcaggttgatgtcgatttcact
gcggtctcagtagcccgagcgaagatcaaccgtgagagatcagctcgaggtgaagggaaa
ctcagtttccttccctttgtcggtcacgcactgtgccgggcgctcgcagaccacccggat
gccaatgccacgttcacggacaagcacctcgtgcgatggaacactgtcaacctgggaatt
gccgtggacactccggacggactgatcgtccccgtcatacgtgatgcgcagaatctcgaa
ctggaggcactgtcggacgcaatagtcgcgaccagtagtgcgatactctcgggttccgcg
cagccggaggatctttcgggcggaacaattacgatcagcaactcgggaagtgtcggcggc
gtggtctcgactccgatcctgactcgtccgcaagttgcctcgatcggtctcccagccatc
gtgcgtacccccgtcgcgcgaaagagcgtcgacggtgaatccgagctcctcaccatcagg
cccattgcacgactcggattgaccttcgaccacagggcattcgacggcgccgaagccttg
cgcacgctgatgtccgtacagaagtatctcgaacaatggccgacaaaatcgtag

DBGET integrated database retrieval system