KEGG   Rhodococcus sp. 008: AOT96_06545Help
Entry
AOT96_06545       CDS       T05462                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00072  Synthesis and degradation of ketone bodies
rhod00280  Valine, leucine and isoleucine degradation
rhod00650  Butanoate metabolism
rhod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOT96_06545
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AOT96_06545
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT96_06545
Enzymes [BR:rhod01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AOT96_06545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: ANQ70561
Position
complement(1386154..1386900)
Genome map
AA seq 248 aa AA seqDB search
MDKVIPTAAEAVADVPDGVTIAVGGFGLVGVPEILIDALLEQGATSLETVSNNCGTDGFG
LGVLLEKGRIRRTVSSYVGSNKEFARQYLSGELEVELTPQGTLAERMRAGGAGIPAFFTP
AGVGTQVADGGLPLRYDGSGGIAVASPPKETRDFDGVTYVMERGIVADYALVHAWKGDRH
GNLVYRASTQNFNPAAATSGRITIAQVEHLVEPGELDPAEIHTPGIHVQRVVHVGPVTVG
IENRTVRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagtcattcccactgctgccgaggccgtcgccgacgtgccggacggcgtcacg
atcgctgtcggaggtttcgggctcgtcggagtgccggaaatcctcatcgatgcgctcctc
gagcagggcgcgacatcactcgaaacggtgagcaacaactgcggcaccgacgggttcggg
ctcggagtgcttctggagaaggggcgtatccgtcgtactgtcagctcgtacgtcggctcc
aacaaggagttcgcgcgtcagtacctttccggtgagctggaagtcgaactcacgccgcag
ggcacgctcgccgagcgcatgcgcgccgggggagcgggcatccccgcgttcttcaccccg
gccggcgtcggcacccaggtcgccgacggcggcctgccactgcgttacgacggcagcggc
ggcatcgcagttgccagtccgcccaaggaaactcgtgacttcgacggcgtcacctacgtg
atggagcgcggcatcgtcgccgactatgcactggtccatgcctggaaaggtgaccggcat
ggcaacctcgtctaccgcgcgagtacccagaacttcaatccggctgcagcaacgtcgggg
cgcatcaccattgcgcaggtcgagcacctcgtagagccgggtgagctcgaccccgccgag
atccacacgccgggcattcacgttcagcgtgttgtccacgtcggccccgtgacggtcggc
atcgagaatcggacggtacgagcatga

DBGET integrated database retrieval system