KEGG   Rhodococcus sp. 008: AOT96_10065Help
Entry
AOT96_10065       CDS       T05462                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00361  Chlorocyclohexane and chlorobenzene degradation
rhod00625  Chloroalkane and chloroalkene degradation
rhod01100  Metabolic pathways
rhod01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AOT96_10065
   00361 Chlorocyclohexane and chlorobenzene degradation
    AOT96_10065
Enzymes [BR:rhod01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AOT96_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ANQ71166
Position
2137813..2138511
Genome map
AA seq 232 aa AA seqDB search
MREKIKALLFDVQGTATDFHSTLCREARRITDADVDWPRFVNLWRAEYFANTSEADDSTG
EWVTVHSVYREALRKLLARESIELSDAEQEELTTAWKFLDPWPDTVAGLTTLRQQYTIAA
LSNADVNAAVSISRHGNLPWHAVFTAEMAGVFKPDPKIYHLAARYLGYDPAEIMMVASHK
YDIRAAKALGFRTAFIARPLEFGARGNPDVSFSDEFDINAEDFLDLAAQLVH
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgagaagatcaaagcactgctgttcgacgtccagggcacagcgaccgattttcac
agcacactgtgccgagaggcccgtcgaatcaccgacgccgacgtggactggccaagattc
gtcaatctctggcgcgctgagtacttcgcgaacacatccgaggccgacgactccacaggc
gaatgggtgacagtacattcggtgtaccgcgaggctctgcgcaagctgttggcccgcgag
agcatcgaactttccgatgccgaacaggaagaactcaccaccgcctggaaattcctggac
ccgtggcccgacactgtcgccggcctgacaaccctgcgccagcagtacacaatcgctgcc
ttgtccaacgccgacgtgaatgccgcagtcagcatctcccggcacggaaatctgccatgg
catgccgtcttcactgccgaaatggccggcgtcttcaaaccagatccgaagatctaccac
ctggctgctcgatatctcgggtacgacccggccgagatcatgatggttgccagtcacaaa
tatgacatccgggcggccaaagctctcggattccgcacagccttcatagctcgaccactc
gaattcggagccaggggcaatcccgatgtgtccttctccgacgagttcgacatcaacgcc
gaggactttctcgatctggcagcgcaattggtccactga

DBGET integrated database retrieval system