KEGG   Rhodococcus sp. 008: AOT96_19760Help
Entry
AOT96_19760       CDS       T05462                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AOT96_19760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rhod03011]
    AOT96_19760
Ribosome [BR:rhod03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AOT96_19760
  Bacteria
    AOT96_19760
  Archaea
    AOT96_19760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANQ72840
Position
4268551..4268955
Genome map
AA seq 134 aa AA seqDB search
MSNTETANPTAKAVAKHVRVTPMKARRVVDLVRGRSVEDALNILKFAPQAASEPVAKVIA
SAAANAENNLDLDPSTLVVATAFVDEGATLKRFQPRAQGRAFRIRKRTSHITVIVESLPK
TGTSTRNRRKGSAQ
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgaaaccgccaacccgactgccaaggctgtagcgaagcacgttcgcgtt
acgccgatgaaggcacgtcgagttgtggacctggtccgcgggcgctcggttgaagacgcc
ctgaacatcctgaagttcgcgccgcaggcagcgagcgagccggtcgccaaggtgatcgcc
tccgcagcagccaacgccgagaacaacctcgacctcgaccccagcacgcttgtcgttgct
acggcgttcgtggacgagggcgcgaccctcaagcggttccagccgcgtgcacagggacgt
gcgttccgtattcgcaagcgcaccagtcacatcaccgtgatcgtggagagcctgccgaag
accggaacatcgacccgtaatcgccggaagggaagtgctcagtag

DBGET integrated database retrieval system