KEGG   Rhodocytophaga sp. 172606-1: GXP67_19605
Entry
GXP67_19605       CDS       T06412                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
rhoz  Rhodocytophaga sp. 172606-1
Pathway
rhoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhoz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    GXP67_19605
Enzymes [BR:rhoz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     GXP67_19605
SSDB
Other DBs
NCBI-ProteinID: QHT68692
UniProt: A0A6C0GM49
Position
4740324..4740683
AA seq 119 aa
MIYIEDAWDINHILNMLKNDDSPGSIGSADISIAFLNDLNAFVIQTGDKEFITSGKGKVG
NPKLSKIKSVEVLSEGHMYLALWKNRVALAAEIENNPKLSTLKSLYMNYKRKKSIKKII
NT seq 360 nt   +upstreamnt  +downstreamnt
atgatatatatcgaagatgcatgggatattaaccatatcttaaatatgctgaaaaatgat
gattcccctggaagtataggttcagctgatataagtatagcctttctgaatgatttaaat
gcttttgttatacaaactggtgataaagagtttataacatctggtaagggaaaagttgga
aatcctaaattatcaaaaataaaatcagtagaagtcctatctgaaggacatatgtatctc
gctctctggaaaaatagagtcgctttggcagctgaaattgaaaataatccaaagctatcc
actttaaaaagtttgtatatgaattacaaaagaaagaagagtattaagaaaataatataa

DBGET integrated database retrieval system