KEGG   Rhodobacter sp. LPB0142: LPB142_03755Help
Entry
LPB142_03755      CDS       T04631                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00071  Fatty acid degradation
rhp00072  Synthesis and degradation of ketone bodies
rhp00280  Valine, leucine and isoleucine degradation
rhp00310  Lysine degradation
rhp00362  Benzoate degradation
rhp00380  Tryptophan metabolism
rhp00620  Pyruvate metabolism
rhp00630  Glyoxylate and dicarboxylate metabolism
rhp00640  Propanoate metabolism
rhp00650  Butanoate metabolism
rhp00900  Terpenoid backbone biosynthesis
rhp01100  Metabolic pathways
rhp01110  Biosynthesis of secondary metabolites
rhp01120  Microbial metabolism in diverse environments
rhp01130  Biosynthesis of antibiotics
rhp01200  Carbon metabolism
rhp01212  Fatty acid metabolism
rhp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB142_03755
   00630 Glyoxylate and dicarboxylate metabolism
    LPB142_03755
   00640 Propanoate metabolism
    LPB142_03755
   00650 Butanoate metabolism
    LPB142_03755
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPB142_03755
   00072 Synthesis and degradation of ketone bodies
    LPB142_03755
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPB142_03755
   00310 Lysine degradation
    LPB142_03755
   00380 Tryptophan metabolism
    LPB142_03755
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPB142_03755
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPB142_03755
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPB142_03755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhp04147]
    LPB142_03755
Enzymes [BR:rhp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPB142_03755
Exosome [BR:rhp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPB142_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOZ68539
UniProt: A0A1D9M9X3
Position
complement(756871..758082)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDACRTPRGKGRPDGSLHEVTSVALSARLLNAVKERNGLEGHAVEDVIWGNVTQ
VGEQGGCLARSAVLLSDLDERIPGLAINRFCASGMEAVNLAANQVKGGAGQAYIAGGVEM
MGRVAMGSDGAAIAVDPSLAMKTYFVPQGISADIIATEYGFTREQADALSVESQRRAAEA
WADNRFAKSIVPVLDQNGLVILDRDEYMRPGTQVEDLAKLKPSFKDMGEMMPGFDKVAML
KYPHLKAVNHIHHAGNSSGIVDGAAAVLIGSKEFGEAHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILKDSGLSIKDLDLFEVNEAFASVVLRFMQAFDVSPDKVNVNGGAMAMGHP
LGATGAIIIGTLLDELERRDLSMGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgacgcgtgccgcacgccgcgcggcaagggccgcccggat
ggaagcctgcatgaagtcacctcggtggcgctctcggcgcggcttctgaacgcggtcaag
gaacgcaacggcctcgagggccatgcggtcgaagacgtgatctggggcaatgtcacccag
gtcggcgaacagggcgggtgcctcgcgcgctcggcggtgctgctctccgatctcgatgag
cggatccccggcctcgcgatcaaccggttctgcgcctcgggcatggaggcggtgaacctt
gccgccaaccaggtcaagggcggcgcgggccaggcctatatcgccggcggcgtcgagatg
atgggccgggtcgcgatgggctcggatggcgcggcgatcgccgtcgacccttcgctcgcg
atgaagacctatttcgttccgcagggcatttcggccgatatcatcgcgaccgaatacggc
ttcacccgcgagcaggccgatgcgctctccgtggaaagccagcgccgcgcggcggaggcc
tgggccgacaaccggtttgccaagtcgatcgtgccggttctcgaccagaacggcctcgtg
atcctcgaccgcgatgaatacatgcgccccggcacccaggtcgaagacctcgccaagctc
aagccctcgttcaaggacatgggcgagatgatgcccggtttcgacaaggtggcgatgctg
aaatacccgcatctgaaggcggtcaaccacatccaccacgccggcaactcctcggggatc
gtcgatggcgcggcggcggtgctgatcggctcgaaggaattcggcgaggcccacgggctc
aagccgcgcgcgcggatccgcgccaccgccaagatcggcaccgacccgacgatcatgctc
accggcccggtgccggtcaccgagaagatcctcaaggactcgggcctctcgatcaaggat
ctcgatctcttcgaggtcaacgaggccttcgcctcggtggtgctgcgcttcatgcaggcc
ttcgacgtttcgcccgacaaggtgaacgtgaacggcggcgcgatggcgatgggccacccg
ctcggcgccaccggcgcgatcatcatcggcacgctgctcgatgagctcgagcggcgcgac
ctgtcgatgggcctcgccacgctgtgcatcgcgtccgggatgggcgccgccacgatcatt
gaacgcgtctga

DBGET integrated database retrieval system