KEGG   Rhodobacter sp. LPB0142: LPB142_05255Help
Entry
LPB142_05255      CDS       T04631                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00260  Glycine, serine and threonine metabolism
rhp01100  Metabolic pathways
rhp01110  Biosynthesis of secondary metabolites
rhp01120  Microbial metabolism in diverse environments
rhp01130  Biosynthesis of antibiotics
rhp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPB142_05255
Enzymes [BR:rhp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LPB142_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOZ68798
UniProt: A0A1D9MAH6
Position
1058760..1059812
Genome map
AA seq 350 aa AA seqDB search
MNFASDNTSGVAPQILAALGRANAGHVPSYGADPLTEAVEAEIRTIFEAPEARVFLVATG
TAANALSCAILTDPWAAIFCHRNAHIEEDECGAPEFFTGGSKLVLVDGEHAKMAPEALRR
AIAHTGRGGVHNVQRGMVSITNATEAGAVYTPDEVAQLSEIARDFHLPVHMDGARFANAL
VACDASPAEMTWRAGVDVLSFGGTKNGCMGVEAVVIFDPARAAEFELRRKRAGHLFSKHR
FLAAQMASYLEGGLWLNLARHANAMAARLAEGLAATPGATLVHPPQANAVFTAFPRAAHI
RAQAGGAQYYLWPFDQSLAGPPEEPLVARLVCSWATTEAEIDAFLALVRG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcctccgacaacacctccggcgtcgcgccgcagatcctcgccgcgctcggg
cgcgccaatgcgggccatgtgccctcctacggcgccgacccgttgaccgaggccgtcgag
gccgagatccgcacgatcttcgaggcgcccgaggcgcgcgttttcctcgtcgcgaccggc
accgcggcgaacgcgctctcctgcgcgatcctgaccgacccttgggccgcgatcttctgc
caccgcaacgcccatatcgaagaggatgaatgcggcgcgccggagttcttcaccggcggc
tcgaagctcgtcctggtcgacggcgaacatgcgaaaatggcgcccgaggcgctgcgccgc
gcgatcgcgcataccgggcgcgggggcgtccataacgtgcaacgcggcatggtctcgatc
accaatgccaccgaggcgggcgccgtctacacccccgacgaggtcgcgcaactctcggaa
atcgcgcgcgattttcatctgccggtgcatatggacggggcgcgcttcgccaatgcgctc
gtcgcctgcgatgcctcccccgccgagatgacctggcgcgcgggcgtcgatgtgctgagc
tttggaggcacgaaaaacggctgcatgggcgtcgaggcggtggtgatcttcgaccccgcc
cgcgccgccgaattcgagctgcgccgcaagcgcgcgggccatctcttctcgaaacaccgc
ttcctcgcggcgcagatggcgagctatctcgagggcgggctctggctcaaccttgcgcgc
cacgccaacgccatggccgcgcggctggccgagggcctggcggcgacgcccggcgccacg
ctcgtccatccgccgcaggccaatgccgtcttcactgctttcccgcgcgcggcccatatc
cgcgcccaggccggcggcgcgcagtactacctctggccctttgaccaatcgctcgctggc
ccgcccgaggagccgctcgtggcgcggctcgtctgctcctgggccacgaccgaggccgag
atcgacgcgttcctggcgctggtgcggggctga

DBGET integrated database retrieval system