KEGG   Rhodobacter sp. LPB0142: LPB142_10985Help
Entry
LPB142_10985      CDS       T04631                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00620  Pyruvate metabolism
rhp00630  Glyoxylate and dicarboxylate metabolism
rhp01100  Metabolic pathways
rhp01110  Biosynthesis of secondary metabolites
rhp01120  Microbial metabolism in diverse environments
rhp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB142_10985
   00630 Glyoxylate and dicarboxylate metabolism
    LPB142_10985
Enzymes [BR:rhp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LPB142_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AOZ69779
UniProt: A0A1D9MDG5
Position
complement(2247365..2249521)
Genome map
AA seq 718 aa AA seqDB search
MIERVERAGLAVAAELAAFIEAEALPGTGVAAERFWSGFAALIADLAPKNRALLARREEL
QARINDWHLKNRARGHDAAAYRAFLAEIGYLEPEGEDFTIETPPTDPEFASVCGPQLVVP
ITNARYALNAANARWGSLYDALYGTDALGAVPEAPGYDPARGAQVIAWAKGFLDTAFPLV
AGPWAEVTRLWVQNGGLFAECGEETGLKDPAQFAGYRGKPEAPEAIVLQNNGLHVIVEVN
PSSRIGADDPAGIADVKLESALSSIMDCEDSVACVDAADKVLAYRNWLGLMRGDLAEKVT
KGGRSFMRALAHDLAFTAPEGGERVLKGRALMLVRNVGHLMTSPAVLDAEGREVPEGLMD
AMVTTLCAVHDLQKTEGARNSVTGSVYVVKPKMHGPEEVRFACEIFDRVEAALGLPRLTV
KLGIMDEERRTSANLKECIRQAKERVAFINTGFLDRTGDEIHTAMEAGPMLRKGEMKSQP
WILAYEDRNVDIGLACGLAGRAQIGKGMWAMPDKMADMLAQKIAHPMAGANCAWVPSPTA
ATLHATHYHKVDVKARQAEIAAMARPARLEDLLTLPLAVGRNYSEAEITEEVENNAQGIL
GYVVRWVDQGVGCSKVPDIHDIGLMEDRATCRISSQALANWLHHGVVSEGRVMEALRKMA
VVVDRQNAADPAYVPMAPDFNGLAFQAACDLIFLGGVQPSGYTEPVLHQRRLQLKAGA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagagagtggagcgcgcggggctggccgtggcggcggagctggcggccttcatc
gaggcggaggcgctgcccggcaccggggttgcggcggagcggttctggtcggggtttgcg
gcgctcattgccgatctcgcgccgaagaaccgtgcgcttctggcccgccgcgaggagttg
caggcgcggatcaacgactggcatctgaagaaccgcgcgcgcggccatgatgcggcggct
tatcgcgcctttctcgccgagatcggctatctcgagccggagggcgaggatttcaccatc
gagacgccgccgacggacccggaattcgcctccgtttgcggcccgcagcttgtcgtgccg
atcaccaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggttcgctttatgat
gcgctttacggcaccgatgcgctcggcgcggtgcccgaggcgccgggctatgaccccgcg
cgtggcgcgcaggtgatcgcctgggcgaagggctttctcgataccgccttcccgctcgtg
gcggggccctgggccgaggtcacgcggctttgggtgcaaaatggcgggctctttgccgaa
tgcggcgaagagaccgggctgaaagaccccgcgcaattcgcaggctaccgcggcaagcct
gaggcgcccgaggcgattgttttgcaaaacaatggcttgcacgtcattgttgaggtcaat
ccgagctcccggatcggcgccgatgatccggccgggatcgccgatgtgaagctcgaatcg
gcgctttcttcgatcatggattgcgaggattcggtcgcttgtgtcgatgcggcggacaag
gttctggcctatcgcaactggctcgggctgatgcgcggcgatctggcggagaaggtcacc
aagggcgggcgcagcttcatgcgcgcgctggcccatgatctcgccttcaccgcgcccgag
gggggcgagcgggtgctcaaggggcgcgcgctgatgctggtgcgcaatgtcggccatctg
atgaccagccccgcggtgctcgatgccgaggggcgcgaggtgcccgaggggctgatggat
gcgatggtgaccacgctctgcgcggtgcatgatctgcaaaagaccgagggcgcgcgcaat
tcggtgaccggctcggtctatgtggtgaagccgaagatgcacggccccgaggaggtgcgc
tttgcctgcgagatcttcgaccgggtggaggccgcgctcggcctgccgcggctcactgtc
aagctcggcatcatggatgaggagcggcgcacctcggccaatctgaaggaatgcatccgc
caggcgaaggagcgcgtggccttcatcaacaccggcttcctcgaccgcaccggcgacgag
atccatactgcgatggaagccgggccgatgctgcgcaagggcgagatgaagagccagccc
tggatcctcgcctatgaggatcgcaacgtcgatatcgggctcgcctgcgggctcgcgggg
cgggcgcagatcggcaaggggatgtgggcgatgcccgacaagatggccgatatgctggcg
cagaagatcgcccatccgatggcgggggcgaattgcgcctgggtgccgagcccgaccgcc
gcgacgctgcatgcgacgcattatcacaaggtcgatgtgaaggcccgccaggccgagatc
gcggcgatggcgcggccggcgcggctcgaggatctgctgaccctgccgctcgccgtgggg
cgcaactattccgaggccgagatcaccgaggaggtcgagaacaacgcgcaaggcatcctc
ggctatgtggtgcgctgggtcgatcagggggtgggctgctcgaaagtgcccgatatccat
gacatcggcctgatggaggaccgcgcaacctgccggatctcgagccaggcgctggcgaat
tggctccatcatggggtggtcagcgagggccgcgtgatggaggcgctgcgcaagatggcg
gtggtggtcgaccggcaaaacgccgccgacccggcctatgtgccgatggcgcccgatttc
aacgggctggccttccaggcggcctgcgatctgatcttcctcggcggggtgcagccctcg
ggctataccgagccggtgctccatcagcgccgcctgcaactcaaggccggcgcctga

DBGET integrated database retrieval system