KEGG   Rhodobacter sp. LPB0142: LPB142_13640Help
Entry
LPB142_13640      CDS       T04631                                 

Definition
(GenBank) oxidoreductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    LPB142_13640
Enzymes [BR:rhp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     LPB142_13640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AOZ70230
UniProt: A0A1D9MEM7
Position
complement(2802624..2803433)
Genome map
AA seq 269 aa AA seqDB search
MSLAITGKTAIITGAAHGIGLAIARHFIDRGAHVMCADIDEAKLNAEFGDEARNDGPVRI
FAGDLCQKLTVNNLLSATVDAYDRIDILINSARAFAPCDPLEPIQDVLEDMLRQNMMGAL
RLSQMTAKRMISLAEKENRTTGEVGTIINVSTLAAQRAQPELLAYSIACAAQDQATRSLA
VALAPYRIRVNGVSFASVMSASLQAALKENGDWREAIVAGTPMGRIAPPSELAETVQYLA
SSGAGFVTGQVIQVDGGRSVIDPIAVPVY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgcaatcaccggcaagaccgcgatcatcaccggcgcggcgcatggcatcggc
ctcgcgatcgcgcgccatttcatcgaccgcggcgcgcatgtgatgtgtgccgatatcgac
gaggccaagctcaacgccgaattcggcgacgaggcgcgcaatgatggcccggtgcggatt
ttcgcgggcgatctgtgccagaagctgacggtgaacaacctgctctcggcgaccgtcgat
gcctatgaccggatcgatatcctgatcaactcggcgcgcgctttcgcgccctgcgacccg
ctcgagccgatccaggatgtgctcgaggatatgttgcgccagaacatgatgggcgcgctg
cggctctcgcagatgaccgccaagcggatgatttcgctcgcggaaaaggaaaatcgcacg
accggcgaggtgggcacgatcatcaatgtctcgacgctggcggcgcagcgcgcccagcct
gagctgctggcctattcgatcgcttgcgcggcgcaggatcaggcgacgcgcagcctcgcg
gtcgcgctcgcgccgtatcggatccgggtcaatggcgtctccttcgcctcggttatgagt
gcgtccttgcaggccgcgctgaaggaaaacggcgattggcgcgaggcgattgtcgcgggc
acgccgatgggccgcatcgcgccgccttcggagcttgccgagacggtgcaatatctcgcc
tcctcgggcgcgggcttcgtcaccggccaggtgatccaggtcgacggcgggcgttcggtg
atcgacccgatcgcggtgccggtctactga

DBGET integrated database retrieval system