KEGG   Rhodococcus sp. p52: IM25_01065Help
Entry
IM25_01065        CDS       T05434                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rhq  Rhodococcus sp. p52
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    IM25_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 UPF0767
Motif
Other DBs
NCBI-ProteinID: AOD20401
UniProt: A0A1B2U8C2
Position
265000..266181
Genome map
AA seq 393 aa AA seqDB search
MTAEFVVLLVVVVTALAFDFTNGFHDTGNAMATSIATGALKPKTAVTLSATLNLVGAFLS
VEVAATVAKGVVDLDTVGGTDLLLIVFAGLVGAILWNISTWLFGLPSSSSHALFGGLVGA
ALASIGVQGVVWDGVLGKVLIPAVLAPVIAGLVSTVGIWSMHRLTRPVSAEHRDRGFRLG
QIGTASLMSLAHGTNDAQKTMGVIFLALVAHGTITADTEMPFWVKVACAVAIALGTYLGG
WRIIRTLGKGLVEIAPPQGLAAESSSAAIILTSSHFGLPLSTTHVATGSILGTGLGTKGA
EVRWSVARRMVVAWVITLPCAAVVGAICWALAHLIGGMSGVLVVFAILCALALFMWLRSR
RQPVDASNVTADWDDKLASAPGASETVSGEGRL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagagttcgtcgtgctcctggtggtggtcgtcactgccctcgcattcgatttc
accaacggcttccacgacaccggcaatgccatggcgacatccatcgccaccggcgccctc
aaacccaaaaccgcggtcactttgtccgcgaccctcaacctcgtcggagccttcctgtcc
gtggaagtcgccgcgaccgtcgcgaagggtgtcgtcgacctcgacaccgtcggcggtacc
gatctgttgctcatcgtcttcgccggtctggtcggagcgatcctctggaacatctcgacc
tggctgttcggcctgccgtccagctcgtcgcacgccctgttcggcggtctcgtcggcgct
gcactggcgtcgatcggtgtccagggcgtggtgtgggacggagtgctgggcaaggtcctg
atccccgccgtgctcgcgcccgtcatcgcggggctggtgtccacggtgggcatctggtcg
atgcaccgcctgacccgccccgtctccgccgagcaccgcgaccgcggcttccggctggga
cagatcggcacggcgtccctgatgtccctcgcgcacggcaccaacgacgcgcagaagacg
atgggcgtgatcttcctggccctcgtcgcccacggcaccatcaccgccgacaccgagatg
ccgttctgggtgaaggtcgcctgtgccgtcgcgatcgcactcggcacctatctcggtggc
tggcgcatcatccgcacgctgggcaagggcctcgtcgagatcgccccgccgcagggcctg
gccgccgagtcgtcgtcggccgccatcatcctcacctcgagccatttcggtctgccgctg
tcgaccacgcacgtcgccacggggtcgatcctcggaacgggtctgggcaccaagggcgcc
gaggtgcgctggtcggtggcgcgacggatggtcgtcgcgtgggtcatcaccctgccgtgc
gccgcggtcgtcggagcgatctgctgggcgctcgcccacctcatcggcggcatgtccggc
gtgctcgtcgtgttcgcaatcctgtgcgccctggccctgttcatgtggctgcgctcgcgc
cggcagcccgtcgacgcctccaacgtcaccgccgactgggacgacaagctcgcctcggcg
ccgggtgcctccgaaacggtcagcggggaaggacgcttgtga

DBGET integrated database retrieval system