KEGG   Rhodococcus sp. p52: IM25_01830Help
Entry
IM25_01830        CDS       T05434                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00564  Glycerophospholipid metabolism
rhq01100  Metabolic pathways
rhq01110  Biosynthesis of secondary metabolites
Module
rhq_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IM25_01830
Enzymes [BR:rhq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     IM25_01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase MFS_2
Motif
Other DBs
NCBI-ProteinID: AOD20536
UniProt: A0A1B2U8R0
Position
413015..413737
Genome map
AA seq 240 aa AA seqDB search
MARKPTPAGTPPTSGVAHMVDLVRHVVPPMHPGGIPFVAAPLAVATLGRRKPWLRRAGLA
SALACATFFRHPHRVPPNRAGVVVAPADGEIALVDHAVPPAELGLGSEERPRVSIFLSVL
DVHVQRSPVGGTVRSVVHTPGKFLSADLADASEVNERTSMLIETRDGAEVAVVQIAGLLA
RRIVNDAQIGDPLPIGDTYGLIRFGSRVDTYLPVGSTLLVERGQRTIGAETVLAQLPTVS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgtaagccgacgcccgccggaacaccccccaccagcggggtagcccacatggtc
gacctggtcaggcatgtcgtaccgcccatgcatccgggcggtatccccttcgtcgcagct
ccgctggccgtggcgaccctcggccgccgcaagccctggctgcgccgcgccggtctcgca
tcggcactggcgtgcgccaccttcttccggcacccgcaccgcgtgccgccgaaccgcgcc
ggagtggtcgtcgctcccgccgacggtgagatcgctctcgtcgaccatgccgtgccgccc
gccgaactcgggctcggcagcgaggagcgcccccgggtcagcatcttcctgtccgtcctc
gacgtgcacgtgcaacgcagccccgtcggcggcaccgtccgctcggtggtccacaccccg
ggcaagttcctctccgccgatctcgccgacgcgagcgaggtcaacgagcgcaccagcatg
ctgatcgagacgcgcgacggcgccgaggtcgccgtcgtccagatcgccgggctgctggca
cggcgcatcgtcaacgacgcgcagatcggcgaccccctgccgatcggcgacacctacggc
ctgatccgcttcggatcccgggtcgacacctacctgccggtcgggagcaccctgctggtc
gaacgcggtcagcgcaccatcggcgccgagaccgtcctcgctcagctgcccacggtgtcg
tga

DBGET integrated database retrieval system