KEGG   Rhodococcus sp. p52: IM25_04735Help
Entry
IM25_04735        CDS       T05434                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00072  Synthesis and degradation of ketone bodies
rhq00280  Valine, leucine and isoleucine degradation
rhq00650  Butanoate metabolism
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IM25_04735
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    IM25_04735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IM25_04735
Enzymes [BR:rhq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     IM25_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AOD21022
UniProt: A0A1B2UA72
Position
complement(1055784..1056530)
Genome map
AA seq 248 aa AA seqDB search
MDKVVASAAEAVADIPDGVTIAVGGFGLVGIPEILINALLDQGATDLETVSNNCGTDGFG
LGLLLEKGRIRRTISSYVGSNKEFARQYLAGELEVELTPQGTLAERLRAGGAGIPAFFTP
AGVGTAVEEGGLPLRYDGHGGIALASQPKETREFDGETYVLERGIVADYALVHAWKGDRH
GNLVYRASARNFNPPAAASGRITIAQVEHLVEPGELDPNEIHTPGIHVQRVVHVGPVEVG
IENRTVRS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagtcgttgcctccgccgccgaggccgtagccgacatccccgacggcgtcacg
atcgctgtcggagggttcggtctggtcggcatccccgagatcctcatcaacgcgttgctc
gatcagggcgccaccgacctcgagaccgtcagcaacaactgcggtaccgacggcttcggg
ctcggcctgctgctcgagaagggccgcatccgccgcaccatctcgtcgtacgtcggctcc
aacaaggagttcgcgcgccagtacctcgccggtgaactcgaagtcgaactcactccgcag
ggcacgctcgccgagcgcctgcgcgccggtggtgcgggcatccccgccttcttcaccccg
gcaggcgtcggaacggccgtcgaggaaggcggactcccgctgcgctacgacggtcacggc
ggcatcgccctcgcgtcgcagccgaaggagacccgggagttcgacggcgaaacctacgtg
ctcgaacgcggcatcgtcgccgattacgcgctcgtgcacgcctggaagggcgaccgccac
ggcaacctcgtctaccgagcaagcgcccgcaacttcaacccgccggccgccgcctcgggt
cgcatcacgatcgcgcaggtcgagcacctcgtcgaacccggcgaactcgaccccaacgaa
atccacacgcccggcatccacgtgcagcgtgtcgtacacgtcggccccgtcgaggtcggc
atcgagaaccggacggtgcgctcatga

DBGET integrated database retrieval system