KEGG   Rhodococcus sp. p52: IM25_18390Help
Entry
IM25_18390        CDS       T05434                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00480  Glutathione metabolism
rhq00590  Arachidonic acid metabolism
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    IM25_18390
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IM25_18390
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     IM25_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AOD23309
UniProt: A0A1B2UGN4
Position
3972488..3973021
Genome map
AA seq 177 aa AA seqDB search
MSVHEYTVATADGGSEDLARFAGRHLLIVNVASKCGLTPQYEALEALHRELGERGLQILA
FPCNQFGGQEPGSDSEIQEFCRVNFDVTFPVFAKVDVNGDDAHPLYRHLRAEAPGDFGPQ
HGFLFEHVSKTRPEAIGTDEVKWNFTKFLVDPQGAVVRRFEPTVTPEEIGKELTDLL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcacgagtacaccgtggccaccgccgacggcggcagcgaggatctcgcccgc
ttcgccggccggcatctgctgatcgtcaacgtcgccagcaagtgcggcctgaccccgcag
tacgaggccctcgaggcgctgcaccgcgagctgggcgagcgcggcctgcagatcctggcg
ttcccgtgcaaccagttcggtggtcaggaaccgggtagtgacagcgagatccaggagttc
tgccgcgtgaacttcgacgtcaccttcccggtgttcgcgaaggtcgatgtcaacggcgac
gacgcgcacccgctttaccggcacctgcgcgccgaggctcccggtgatttcgggccgcag
cacggtttcctgttcgagcacgtgagcaagacccgtccggaggcgatcggcaccgacgag
gtgaagtggaacttcaccaagttcctcgtcgacccgcagggtgcggtggtgcgccgcttc
gagccgacggtcacccccgaggagatcggcaaggaactcaccgacctgctctga

DBGET integrated database retrieval system