KEGG   Rhodococcus sp. PBTS 2: A3Q41_00221Help
Entry
A3Q41_00221       CDS       T05030                                 

Gene name
rlmAII
Definition
(GenBank) 23S rRNA (guanine(748)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
rhs  Rhodococcus sp. PBTS 2
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rhs03009]
    A3Q41_00221 (rlmAII)
Enzymes [BR:rhs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A3Q41_00221 (rlmAII)
Ribosome biogenesis [BR:rhs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A3Q41_00221 (rlmAII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: AMY21545
UniProt: A0A143QED5
Position
complement(242665..243543)
Genome map
AA seq 292 aa AA seqDB search
MLTDVVELLVCPQCRVREVESGLGLGETDRSLWCDRGHSFDVARQGYVSLLTGDGGKFTG
DSAEMVAAREKFLGGGHFEPIAAAVSAAVPPESDVVLDVGVGTGYYLAGVLDARPAALGV
GVDVSKFAARRAARSHTRLGCVVADVWSGLPIRAGAVSAVTCVFSPRNAGELHRVLGDDG
TLVVVTPTSRHQRELRGPLGLIGVEEDKTRRLGESLSGLFESVAETPLEYSMMLSHNDIE
ELIGMGPSIRHGDPDARSVALKDLPDTVPVTASVTVSTYRKVSQPRRASASL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgacgtcgtcgaattgctggtctgcccacagtgccgcgtccgtgaggtcgag
tcgggcctgggtctcggcgagaccgatcggagtctgtggtgcgatcgtggtcattcgttc
gacgtggctcggcaggggtacgtcagcctgttgaccggcgacggcggcaagttcaccggt
gattcggccgagatggtcgcagcccgtgagaagttcctcggtggcggtcatttcgagccc
atcgcggcggcggtgtcggccgctgttccgcccgagtcggacgtggtcctcgatgtcggg
gtgggcaccgggtattacctcgcaggtgtcctggacgcgcgtccggccgcgctgggggtc
ggggtggacgtgtccaagttcgcggcacgccgagccgcgcggtcgcatacccggctcggg
tgcgtcgtcgcggacgtctggagcgggctaccgattcgggcgggtgccgtgtctgcggtg
acgtgtgtgttctcgccgcgcaatgccggtgaactgcatcgagttctcggcgacgacggc
acgttggtggtcgtcacgccgacgtcgcggcatcagcgagaactgcgcgggccgctgggg
ctgatcggcgtcgaagaggacaagacccgtcggctcggtgagtcgctgtcgggtctgttc
gagtcggtggccgagaccccgctcgagtactcgatgatgctctcgcacaacgacatcgag
gaactcatcggtatggggccgtcaattcggcacggtgaccccgacgcgcggtccgtggcg
ttgaaggatttgcccgacactgtcccggtcaccgcgtcggtgacggtgtcgacctaccga
aaggtgtctcagccccgacgcgccagcgcgtcgttgtag

DBGET integrated database retrieval system