KEGG   Rhodococcus sp. PBTS 2: A3Q41_00893Help
Entry
A3Q41_00893       CDS       T05030                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q41_00893
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A3Q41_00893
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A3Q41_00893
    1.1.1.-  
     A3Q41_00893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMY22211
UniProt: A0A143QH15
Position
complement(906280..907338)
Genome map
AA seq 352 aa AA seqDB search
MRAAVYYGPNKVEITDVPEPNPGAGQVKVKVGFNGICGTDLHEYYAGPIFIPTSPHPLTG
QEMPLVLGHEFSGTVTELGTGVTGISVGDRVAIEPLYRCGHCGPCRAGNYNICAQIGFHG
LMSDGGMAEYTVVPTDMIHALPDNVSLELGALVEPMSVAYHAATLGDPKPEDTAMVFGAG
PIGIGLWFALRGKGLDNVYVVEPSPTRRASIEALGAKTLDPTAVDVPAFIADLTDGNGAD
AIYDAAGVQPAVETALGCIGARKPLVSVAIYEKPLTTPLQKLVMNESRIQGSLCYTSADY
EAVIDLMSQGHYDTTGWVDKITLDGVIDDGFEALHAGTKMKVLVDPSTGVPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcagctgtgtattacggcccgaacaaggtggagatcaccgacgtacccgagccg
aatcccggtgcggggcaggtcaaggtcaaggtcgggttcaacggaatctgcggaaccgac
ctgcacgagtactacgccggccccatcttcatccccacctcgccgcatccgctgaccggc
caggaaatgcccctggtgctcggacacgagttctcgggcacggtcaccgagctcggcacg
ggtgtcaccggcatctcggtcggcgatcgcgttgccatcgaaccgctctaccgctgtgga
cactgcggaccctgccgggcaggtaactacaacatctgcgcgcagatcggcttccacgga
ctgatgtccgacggcggaatggccgaatacaccgtggtccccacggacatgattcacgcc
ctacccgacaacgtctctctcgaactcggtgccctcgtcgaaccgatgtcggttgcctat
cacgctgcgacactgggggatccgaagcccgaggacaccgcgatggtgttcggagccggc
cccatcggcatcggcctgtggttcgcgttgcgcggtaagggactcgacaacgtctacgtc
gtcgaaccgtcgccgacgcgtcgggcctcgatcgaagcgctcggtgccaagaccctcgac
ccgacggcagtcgatgtccccgcgttcatcgccgatctgaccgacggcaacggggccgac
gccatctacgacgcggccggtgtgcaaccggccgtcgagaccgcgctgggctgcatcggt
gctcgcaaaccgctcgtcagcgtcgcgatctacgaaaagccgctcaccacaccgctgcag
aagctcgtcatgaacgaatcccgcatccagggatcgctctgctacacctccgccgactac
gaggccgtcatcgatctgatgagccagggccactacgacacgacgggctgggtggacaag
atcacgctcgacggcgtcatcgacgacggattcgaggcgctgcacgcaggcaccaagatg
aaagttctggtcgacccctcgacgggtgtacccgcatga

DBGET integrated database retrieval system