KEGG   Rhodococcus sp. PBTS 2: A3Q41_01200Help
Entry
A3Q41_01200       CDS       T05030                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00051  Fructose and mannose metabolism
rhs01100  Metabolic pathways
rhs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A3Q41_01200 (fucA)
Enzymes [BR:rhs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A3Q41_01200 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AMY22511
UniProt: A0A143QHW6
Position
complement(1223537..1224199)
Genome map
AA seq 220 aa AA seqDB search
MPADVDELRESVAETARQLGRRGLVLGTAGNVSARAGDVVAVTATGLVLAEATIEDVTLV
GMDAIVRAGASEPTSELGLHLGLYASSEVQSVVHAHSSAAVALSLVANELPPVHYAQLTL
GGRVPVVPFAPFGTDELADAVVTAMRSRSAVIMAHHGSVATGHDLGAALSNIELLEWLCG
VYLSAASVASPRSLEDAQLAATLDEVVRRAYGTSAPVRRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgacgtggacgaacttcgagagtccgtcgccgagaccgcccggcaactgggc
cgacggggcctggttctcggtaccgcaggcaatgtcagcgctcgcgcaggtgatgtggtg
gcggtgacggcgaccggactggtgctggccgaggcgacgatcgaggacgtcacactcgtc
ggtatggacgcaattgtgcgcgccggtgcgtctgagccgacctcggaattgggcctgcac
cttggcctctacgcgtcgtccgaggttcagtcggtggtgcatgcacattcttctgcagcc
gttgctctttcgctcgtcgcgaacgaactgccgcccgtgcactacgcgcagctgacactc
ggcggcagggtcccggtggtgccgttcgcgccgttcggtacggacgagctcgccgacgcg
gtggtgacggcgatgcgttcgaggtcggcagtgatcatggcccatcacggatcggtcgcc
accggccacgatctcggggccgctctgtcgaacatcgaactgctcgaatggctctgcggg
gtctatctttccgctgcgtcggtggcgagcccacgcagcctcgaagacgcgcagctggcg
gccacactcgacgaggtggtgcgccgtgcctacggaacctcggcacccgtgcgccgagac
tga

DBGET integrated database retrieval system