KEGG   Rhodococcus sp. PBTS 2: A3Q41_03626Help
Entry
A3Q41_03626       CDS       T05030                                 

Gene name
cobQ_2
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00860  Porphyrin and chlorophyll metabolism
rhs01100  Metabolic pathways
Module
rhs_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A3Q41_03626 (cobQ_2)
Enzymes [BR:rhs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     A3Q41_03626 (cobQ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase MobB Peptidase_S51 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AMY24912
UniProt: A0A143QQY3
Position
3765929..3767458
Genome map
AA seq 509 aa AA seqDB search
MKGALLVAGTTSDAGKSVLVAGLCRMLARRGVRVAPFKAQNMSNNSVVTLDGGEIGRAQA
MQAAACGLEPSVRFNPVLLKPGSDRTSQLVVRGRAVAQVSASNYIEHRQALRHVVADELS
SLRAEFDVVICEGAGSPAEINLRATDLANMGLARAASLPVIVVGDIDRGGVLAHLFGTVA
VLSPEDQALVAGFVINKFRGDPALLAPGLDQLRALTGRPTYGVVPFADGLWMDAEDSLGT
VPDAPVGRPRPPLGSQWLRVAAVRLPRISNTTDVEALACEPGVSVHWVTEPSRLEDADLV
VVPGSKSTVSDLEWLRRTGLARALSERAAAGRPVLGICGGYQMLGRTISDSVESGVGTVE
GLGLLDLDIEFAAEKVLVQVSGRSVTFGSDPVRGYEIHHGRVVRNDDDALLTTAGGVGEG
SVRGGVVGTHWHGLLESDDFRRSFLAWVAEKAGRAGFEVASDTSVAALREQQLDLLADLV
DSNIDIDAVLDLIENGVDGSTRKIVTQML
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggcgctctgttggtcgccggcactacctccgatgcaggcaagagtgtgttggtc
gccggcctgtgccggatgctggcgcggcggggtgttcgggtggccccgttcaaggcgcag
aacatgtcgaacaactcggtcgtcacgttggacggcggcgagatcggccgggctcaggcg
atgcaggctgccgcctgtggcctcgagcccagcgtgcggttcaatccggtgttgctcaag
cccggcagtgatcggacgtcgcagttggtggtgcgcgggcgtgcggtggcccaggtgagt
gcgagcaactacatcgaacatcggcaggcgctccggcatgtggtcgccgacgagttgtcc
tcgctacgtgccgaattcgacgtggtgatctgcgagggtgccggttcaccggccgagatc
aatctacgcgccaccgatctggccaacatggggttggcgagggcggcgtcgctgccggtg
atcgtggtgggcgacatcgaccgcgggggagtgctggcacacctgttcgggacggtggcg
gtgttgtcacccgaggatcaggctctcgtggcagggttcgtgatcaacaagtttcggggt
gatccggctctgttggcaccggggctcgaccagttgcgggcgttgaccgggcggccgacg
tacggagtcgttccgttcgccgacgggttgtggatggacgcggaggattcgctcggcacc
gttcccgatgcgcccgtcggcaggccccgtcctccgctcggctcgcagtggctgcgggtg
gcggcggtgcgattgccgaggatctccaacacgaccgatgtcgaggcgctggcgtgcgag
cccggagtgtcggtgcactgggtcaccgagccttctcggctcgaggatgcggatttggtg
gtcgtccccggcagcaagtccacggtgtcggatctggaatggttgcggcgcaccggtctt
gctcgtgccctttccgagcgcgccgctgcggggaggccggttctcggcatctgcggcggt
taccagatgttgggccgaaccatctctgattccgtggagtcgggcgtcggaacggtcgag
ggactgggattgctcgatctcgacatcgaattcgcggccgagaaggtactcgtgcaggtg
agtggtcgttccgtcacattcggctcggatcccgtgcgggggtacgaaattcaccatgga
cgagtggtccggaacgacgacgatgcgctgctgacgaccgcggggggcgtcggcgagggc
agtgtgcgtggcggtgtcgtgggaactcactggcacggactcctcgaatccgatgatttc
cgtcgatcctttctcgcctgggtggcagagaaggcgggtcgcgcgggattcgaggttgcg
tccgacacgtcggttgcggccctacgggaacagcagttggatctgctggccgatctggtg
gacagcaacatcgatatcgacgccgttctcgatctgatagagaacggcgtcgacggctcg
acgagaaagatcgtcacgcagatgctttga

DBGET integrated database retrieval system