KEGG   Rhizobium sp. NT-26: NT26_0264Help
Entry
NT26_0264         CDS       T04765                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00030  Pentose phosphate pathway
rht00480  Glutathione metabolism
rht01100  Metabolic pathways
rht01110  Biosynthesis of secondary metabolites
rht01120  Microbial metabolism in diverse environments
rht01130  Biosynthesis of antibiotics
rht01200  Carbon metabolism
Module
rht_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rht_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
rht_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NT26_0264 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NT26_0264 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rht04147]
    NT26_0264 (zwf)
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NT26_0264 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NT26_0264 (zwf)
Exosome [BR:rht04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NT26_0264 (zwf)
  Exosomal proteins of colorectal cancer cells
   NT26_0264 (zwf)
  Exosomal proteins of bladder cancer cells
   NT26_0264 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CCF17989
UniProt: L0NAU8
Position
complement(262547..264019)
Genome map
AA seq 490 aa AA seqDB search
MSSQIIPVDPFDCVVFGGSGDLAERKLLPALYHRQVEGQFLEPTRIIGASRSPLSDEEYR
TFARDALREHLKPGEYNDAEVERFCKRLFYIPVDAKSDQGWDKLKKLLDGGKDCVRVFYL
AVAPSIFGAISEKIRDHKLITKQTRIVVEKPIGRDLASALELNDTIGRVFQEEQIFRIDH
YLGKETVQNLMALRFANALYEPLWNAQHIDHVQITVAEAVGLEGRAGYYDTAGALRDMVQ
NHILQLLCLVAMEVPSSLSAEAVRDEKLKVLRALKPITEGNVEHMTVRGQYRAGASAGGP
VKGYLDELEGGVSNTETFVAIKAEIGNWRWAGVPFYIRTGKRLATRVSEIVITFKPIPHN
IFDQAAGRISANQLIIRLQPDEGVKQSLMIKDPGPGGMRLRGVSLDMSFAEAFAVRNPDA
YERLLMDTIRSNQTLFMRRDEVEAAWQWVDPILKGWESTGQAVQGYTAGTWGPSQAIALI
ERDGRTWHEG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagattatcccggtcgatccctttgattgcgtcgtgtttggcggatcgggc
gaccttgcggaacgaaagctgttgccggcgctctatcatcgacaggtcgagggacagttc
ctcgagcccacccgcatcatcggtgcgtcccgcagcccgctttccgacgaagagtatcgg
acctttgcgcgtgacgcgctccgcgagcatctcaaacccggagaatacaatgacgccgag
gtcgagcgcttctgcaagcggctgttctacatccctgttgacgcgaaatcggatcagggc
tgggacaagctcaagaagcttctggacggcggcaaggattgcgtccgcgtcttctatctt
gccgttgctccgtcgatcttcggcgccatctcggaaaagatccgcgaccacaagctgatc
accaagcaaacccggatcgtcgtggagaagccgatcggccgcgacctcgcgtctgcactg
gagctcaatgacaccatcggccgggtattccaggaagagcagatcttccgcatcgatcac
tacctcggcaaggagacggtgcagaacctgatggcgctgcgcttcgccaatgccctctac
gagcctctctggaacgcgcagcacatcgaccacgtgcagatcaccgttgcggaggccgtc
ggactggaaggccgcgccggctattacgacacggccggcgcactgcgcgacatggtgcag
aaccacatccttcaactgctctgccttgtcgccatggaagtcccctcttcgctgagcgcc
gaggcggtgcgagacgagaagctcaaggtcttgcgggcacttaagcccatcaccgagggc
aatgtcgagcacatgactgtgcggggccagtaccgagcgggagcatctgctggagggccg
gtaaaaggttacctggacgagttggaaggcggcgtctccaacaccgagaccttcgttgcc
atcaaggctgagatcggaaattggcggtgggccggagtgcccttctacatccgcacgggc
aagcggctggcgacacgagtgtcggagatcgtcatcaccttcaagccgatcccccacaac
atcttcgaccaggcagcggggcgcatctccgccaaccagctgatcattcggctgcagcca
gacgaaggcgtcaagcagtcgctgatgatcaaggaccctggtcccggcggcatgcgcctt
cgcggcgtctcgctcgacatgagctttgccgaagccttcgccgtccgcaatccggatgcc
tacgaacgcctgctgatggatacgatccgctcgaaccagacgctgttcatgcgtcgcgac
gaggtcgaggcggcctggcagtgggtagatccaatcctgaagggctgggaatccaccggc
caggcagtccagggctacaccgcaggaacgtggggtccaagccaggcaatcgcgctgatc
gagcgcgacggccgcacatggcacgagggttga

DBGET integrated database retrieval system