KEGG   Rhizobium sp. NT-26: NT26_3632Help
Entry
NT26_3632         CDS       T04765                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00071  Fatty acid degradation
rht00072  Synthesis and degradation of ketone bodies
rht00280  Valine, leucine and isoleucine degradation
rht00310  Lysine degradation
rht00362  Benzoate degradation
rht00380  Tryptophan metabolism
rht00620  Pyruvate metabolism
rht00630  Glyoxylate and dicarboxylate metabolism
rht00640  Propanoate metabolism
rht00650  Butanoate metabolism
rht00900  Terpenoid backbone biosynthesis
rht01100  Metabolic pathways
rht01110  Biosynthesis of secondary metabolites
rht01120  Microbial metabolism in diverse environments
rht01130  Biosynthesis of antibiotics
rht01200  Carbon metabolism
rht01212  Fatty acid metabolism
rht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NT26_3632
   00630 Glyoxylate and dicarboxylate metabolism
    NT26_3632
   00640 Propanoate metabolism
    NT26_3632
   00650 Butanoate metabolism
    NT26_3632
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NT26_3632
   00072 Synthesis and degradation of ketone bodies
    NT26_3632
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NT26_3632
   00310 Lysine degradation
    NT26_3632
   00380 Tryptophan metabolism
    NT26_3632
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT26_3632
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NT26_3632
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NT26_3632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rht04147]
    NT26_3632
Enzymes [BR:rht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NT26_3632
Exosome [BR:rht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT26_3632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCF21354
UniProt: L0NKC8
Position
complement(3566931..3568100)
Genome map
AA seq 389 aa AA seqDB search
MTTAQIVGWAHSKFGKSEAPTTRALMAEVINPALAHAGIEAKGVDGIFVGVFNNGFTKQD
FQGALVAMAADGFTHTPAARMENACATGSAAIYSALDFIGSGRGRVALVVGAEKMTSLPT
KETGDVLLGASFREEEADIEGGFAGLFGRIANNYFQRYGDRSEELAMIAAKNHANGMANP
YAHMQRDFSFDFCNTVSDKNPYVAAPLRRTDCSLVSDGAAALVLAHPDVAEGMQRAVAFR
ARTHVNDILAMSRRDPIAFDGARLAWQKSLSEAGLTLDDLDFVETHDCFTIAELIEYEAM
GLAKPGEGYKVVREGLAAKGGKLPVNPSGGLKSKGHPVGATGVSMHVMAAMQLCGEAGDM
QLPNAGKAGVFNMGGAAVANYVSILERVT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcacagatcgtcggctgggcacactcaaagttcgggaaatccgaagcgccc
accacgcgagcactcatggcggaagtgatcaacccggcgctcgctcatgcgggcatcgag
gccaagggcgttgatggcatctttgtcggcgtcttcaacaacggctttaccaagcaggat
tttcagggtgcgcttgtcgccatggctgcagatggcttcacccatacgccggcagccagg
atggagaatgcctgtgcgaccggatcggcggcgatctattcggcgctggatttcatcgga
tcggggcgaggccgcgttgcgctggtcgtcggcgcggagaagatgacctccttgccgacc
aaggagacgggcgacgtgcttctgggcgcgtcattccgtgaggaggaagcagatatcgaa
ggcggttttgccggactcttcggacggatcgcgaacaactatttccagcgatacggcgac
cgttcggaagagttggcgatgattgccgccaagaaccatgcaaatggcatggccaacccc
tatgctcacatgcagagggacttctccttcgacttctgcaacacggtctccgacaagaat
ccctatgtcgcggcaccgcttcgacggaccgactgctccctcgtttcggacggagcggcg
gccctggtgctcgcccaccccgacgtcgcagaaggaatgcagcgcgccgttgccttccgc
gcccgaacgcatgtcaacgacatcctcgccatgtcgcgccgcgatcccattgcgttcgac
ggtgcgcgccttgcctggcaaaagtccctttcggaggcggggctgacgctggatgatctc
gatttcgtcgagactcatgactgcttcacaattgctgagctgatcgaatatgaggccatg
ggattggctaagcctggcgagggctacaaggtcgtccgcgagggactggccgcaaagggc
gggaagctgccggtcaatccttctggcggcttgaaatcgaaggggcatccggtaggtgcc
accggggtctccatgcatgtcatggcggcgatgcagctctgcggcgaggccggcgacatg
caactgccgaatgccgggaaggctggggtcttcaacatgggtggcgcggccgtcgccaac
tatgtctcaattctcgaacgggtaacgtaa

DBGET integrated database retrieval system