KEGG   Rhodococcus sp. PBTS 1: A3Q40_00611Help
Entry
A3Q40_00611       CDS       T05182                                 

Gene name
dehH2
Definition
(GenBank) Haloacetate dehalogenase H-2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00361  Chlorocyclohexane and chlorobenzene degradation
rhu00625  Chloroalkane and chloroalkene degradation
rhu01100  Metabolic pathways
rhu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A3Q40_00611 (dehH2)
   00361 Chlorocyclohexane and chlorobenzene degradation
    A3Q40_00611 (dehH2)
Enzymes [BR:rhu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A3Q40_00611 (dehH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AMY18019
UniProt: A0A143Q4Z4
Position
653637..654341
Genome map
AA seq 234 aa AA seqDB search
MGKRVGMTTPAAPEVFVFDVVGTLADLQPVENRMQARGLPAGSLDPWFRHMLRDAMALTL
AGDYLPFTDVAASALHSHTRGALSDDDVEWILGGFSETRPHPDAVPAVDAALKSGARVFA
LSNGAASSTEGFLDRAGIRDRVEQILSIDDVRAWKPSPAPYRLAVERAGVPASSMAMIAV
HGWDLHGASRVGLRTGWCSREEGVLTPAFARPDVVADRLDDVVRGLATPSVTSE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagcgcgtcggtatgacaaccccagccgcacccgaggtcttcgtcttcgacgtg
gtcggaaccctcgcagatctgcagcccgtggagaaccgcatgcaggcccgcggactcccc
gccggctcgctcgacccgtggttccgccacatgcttcgcgacgcgatggccctcacgttg
gcgggcgactacctcccgtttaccgacgtcgccgcgtccgccctgcacagccacacccgc
ggggcgttgtccgacgacgacgtcgagtggattctgggcggcttctccgagactcgaccc
caccccgacgccgtgcctgccgtcgacgccgcactgaaaagcggggcgcgggtgttcgcg
ctgtccaacggtgcggcgtcgtcgaccgagggctttctcgaccgggcggggatccgcgac
cgggtggagcagatcctgtcgatcgacgacgtccgcgcttggaagccgtcgcccgcgccc
taccgcctggccgtcgagcgggccggggtgcccgcatcgtcgatggccatgatcgccgtg
cacgggtgggacctgcacggcgccagtcgagttggtctgcgcaccgggtggtgttcccgc
gaggagggcgtgctgacgccggcgttcgcgcgcccggacgtcgtcgccgacaggctcgac
gacgtcgtccgggggctggcgaccccgagcgtcaccagcgagtga

DBGET integrated database retrieval system