KEGG   Rhodococcus sp. PBTS 1: A3Q40_00732Help
Entry
A3Q40_00732       CDS       T05182                                 

Gene name
recC
Definition
(GenBank) RecBCD enzyme subunit RecC
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    A3Q40_00732 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhu03400]
    A3Q40_00732 (recC)
Enzymes [BR:rhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A3Q40_00732 (recC)
DNA repair and recombination proteins [BR:rhu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A3Q40_00732 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AMY18140
UniProt: A0A143Q4U7
Position
802267..805590
Genome map
AA seq 1107 aa AA seqDB search
MLEIHRAERSDTLADALAHLLRTPLADPFTTEIVAVPAKGVERWLHQRLSGVLGVGSERM
ADGIAAGIEFPSPSRLVDDVVSTVGGIDPADDPWAADAAVWATLRTIDECTAEPWCAVLA
ASIGAAAEFDESDGADEHRRGRRWSTAARVSGLVRTYAAQRPAMLRDWAAGVDSDGAGGD
LPDDLRWEAELFRRLRGRLGPHPAERWETVCAQLRQEPGLLSLPERVSVFGPTRLSTAQR
DVLHALAAHRAVHLWLPHPSPALWDAASTIAPGSRRRQVDRALSGGHPLLVSLARDVREL
RPLVAPMADSDEYLTPEPDSAGDTVLRRLQRDVVADRAPSPEVGVEFDGSVEVHACHGAA
RQVDVLRDALLHAFRDDPTLEPRDVLVMCPDVETFAPLIRAAFGGTAAAAPGVRRVSGHP
AHTLRVRLADRGLRRTNPVLEVVATMIELGTARVTATQMLDVAALSAVRTRFRFTDDDLE
RLREWTRESGARWGIDTVQRSAFGLRDFEQNTFSAALDRLLLGAAADESTGEWLGLALPV
DDVDGADLDLVGRFAELVDRVSKVLHGLRGERPATEWRDHLVLAMDLLADVRPSDDWIRA
DAGREISAAFEGAGDVPLRSADVRALLDERFAGRPTRSNFRTGELTVCTMVPMRSVPHRV
VALLGLDDDVFPRVGHVDGDDVLARDPVVGERDVRSEDRQLLLDAVMAATDRLLLFYTGA
NPTTGVVEPPAIPLADVIDAVTATAGRSPVVRHPLQPFDPSSFAAAAPRSFDPAALAGAR
ALQRPPAPAPPFLAEPLPPAPAEDVDLTDLLAFVRNPIGAFLRQRLQVRADITEDEIEDA
LAVQLAPLAKWALGDRMLTQMLSGVDAARIRAAEWRRGSLPPHHQGRRELEDVEFVVGEV
YRAAAPVHVGVPDTLDVAVDLGEGRRLTGSVPGVHGTTVARARYSTLSAVHRLEAWVHLV
ALTAQDPSRGWTAVTTGRTSNRALRQVLRTPDAATDVLRDLVDLRDRGLRGPLPLTTKAG
CLYADRVTNGVREDAALEAAEREFGGFGDGSDAAVRLVHGPTVAFRDITAETPRDEERAW
SPDPTRFGVLARRLWAPLLAHETLERQ
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagattcatcgcgccgagcgctccgacactctggccgacgccctggcgcacctg
ctgcgcacgccgctcgcggatccgttcaccaccgagatcgtcgccgtgccggccaagggt
gtggagcggtggctgcatcagcgactgtccggcgtcctcggcgtcggctccgagcggatg
gccgacggcatcgccgccggcatcgagttcccctcgccgagtcggctcgtggacgacgtc
gtgtccaccgtcggcgggatcgatcccgccgacgatccgtgggcggcggacgccgcggtg
tgggcgacgctgcggaccatcgacgagtgcacggccgagccgtggtgcgccgtgctcgcc
gccagcatcggcgccgctgccgagttcgacgagtccgacggtgcggacgagcatcggcgc
gggcgccgttggtccaccgctgcccgggtgtcggggttggttcgcacctacgccgcgcag
cggcccgccatgctccgggactgggccgccggggtcgactccgacggggcgggcggcgac
ttgccggacgacctccgatgggaggccgagctgttccgccgtctgcgaggccggctcggc
ccgcacccggcggagcggtgggaaacggtctgcgcgcagctccggcaggagcccggcctg
ctctcgctgcccgagcgggtgtcggtgttcgggccgacccgactgagcaccgcgcagcga
gacgtcctgcacgcgctcgccgcacaccgggcggtccacctctggttgccgcatccctca
ccggctctgtgggacgcggcctcgaccatcgcgcccgggagtcggcgccgacaggtcgac
cgcgctctgtccggcggacacccactgctggtgagtctggcgcgggacgtccgcgaactc
cgcccgctcgtcgccccgatggccgattcggacgagtacctgacccccgagcccgattcc
gccggcgacaccgtgttgcggcgactgcagcgtgacgtcgtcgccgatcgtgcgccgtcg
ccggaggtcggggtcgagttcgacggcagcgtcgaggtccacgcgtgccacggtgcggcc
cgccaggtcgacgttctgcgggacgcgttgctccacgccttccgggacgacccgaccctc
gaaccgcgggacgtcctcgtcatgtgcccggacgtcgagaccttcgcgccgctgatccgc
gcggcgttcggcggtaccgcggccgcagctccgggggtgcggcgggtgtccggtcacccc
gcgcacacgctccgtgtccggctggccgatcgagggctgcggcgcaccaacccggtgctc
gaggtcgtcgccacgatgatcgagttgggcaccgcccgcgtgacggcgacgcagatgctc
gacgtcgccgccctctcggccgtccgcacgcgattccgattcaccgacgacgacctcgag
cgcctgcgggagtggacgcgggagtcgggcgcacggtggggaatcgacaccgtgcagcgg
tcggcgttcgggcttcgcgacttcgagcagaacaccttctcggcggcgctcgaccgcctg
ctgctgggggcggccgccgacgagtccaccggcgaatggttggggctcgcgctgccggtc
gacgacgtcgacggcgccgacctcgacctggtgggtcggttcgccgaactggtcgaccgc
gtgtcgaaggtgctccacgggctgcgcggcgaacgtcccgccacggagtggcgcgatcat
ctggtgctcgcgatggacctgctggccgacgtgcgtcccagcgacgactggatccgcgcg
gacgccggtcgcgagatctccgcggccttcgagggtgcgggcgacgtgccgctgcggtcc
gccgacgtgcgcgcccttctggacgagcgattcgccggccgtcccacgcggtcgaacttc
cgcaccggcgaactgaccgtctgcaccatggtgcccatgcgatcggtgcctcaccgcgtg
gtcgcgttgctcggtctggacgacgacgtctttccccgcgtgggccacgtcgacggtgac
gacgtgctcgcgcgggaccccgtcgtcggggaacgggacgtgcggagcgaagaccggcag
ctgctgctcgacgcggtgatggcggccaccgatcggctgctgctgttctacaccggcgcg
aacccgaccaccggtgtggtcgagccgccggccattccgctcgccgacgtgatcgacgcg
gtcacggcgacggccggacgatcgcccgtcgtccgacaccccctgcagccgttcgatccg
tcgtcgttcgcggcggcggccccgcgcagcttcgatccggccgccctcgccggggcgcga
gcgttgcagcgtccgcccgcgccggcacctccgttcctggccgagccgctgccgcccgcc
ccggcggaggacgtcgacctgaccgatctgctcgcgttcgtgcgcaacccgatcggggcg
ttcctgcggcagcgtctgcaggtgcgggcggacatcaccgaggacgagatcgaggacgcc
ctcgcggtgcagctggcgccgctggcgaagtgggcgctgggcgatcgcatgctcacccag
atgttgtcgggcgtcgacgccgcgcggatccgcgcggcggagtggcgtcgtggctccctg
cccccgcatcaccaggggcgtcgtgaactcgaggacgtcgagttcgtcgtcggtgaggtg
taccgcgccgcggcgcccgtccacgtcggtgttcccgacaccctcgacgtcgccgtcgac
ctcggggagggacgccgactgacaggcagcgttcccggtgtccacggcaccaccgtcgcg
cgcgctcgctactcgacgctgagtgccgtgcatcggctggaagcctgggtgcatctagtg
gcgctgaccgcgcaggacccgtcgcgcgggtggacggcggtgaccaccggccgcacctcg
aaccgggcgctccgtcaggtactccgcaccccggacgcggcgacggacgtcctgcgcgat
ctcgtcgatctgcgggaccgaggactgcggggacccttgccgctgaccacgaaggccggc
tgcctgtacgccgaccgggtgaccaacggggtccgcgaggacgcggcgttggaggccgcg
gaacgtgagttcggagggttcggcgacggctccgacgccgccgtgcgtctggtccacggg
ccgacggtcgcctttcgggatatcaccgccgagactccgcgggacgaggaacgggcctgg
tcgccggaccccacccggttcggggtgctggcccgtcgactctgggcgccgctgttggct
cacgagaccctggagcgtcagtga

DBGET integrated database retrieval system