KEGG   Rhodococcus sp. PBTS 1: A3Q40_01823Help
Entry
A3Q40_01823       CDS       T05182                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q40_01823 (gutB_1)
Enzymes [BR:rhu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A3Q40_01823 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A3Q40_01823 (gutB_1)
    1.1.1.-  
     A3Q40_01823 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 ADH_zinc_N_2 NADH_4Fe-4S DUF2303
Motif
Other DBs
NCBI-ProteinID: AMY19208
UniProt: A0A143Q952
Position
complement(1987001..1988047)
Genome map
AA seq 348 aa AA seqDB search
MRAAVYHGPHRVEIEDVPTPEPGPGEVAVDVAFNGICGTDLHEYYAGPIFVPTSPHPLTG
RQAPLTMGHEFSGTVAAVGPGVDGWAVGDRVAVEPIHRCGQCPPCRAGNYNVCQRIGFHG
LMSDGGMAERTVVPVHMLHRLPDSVSLELGALVEPMSVAYHAATLGEPPADGTALVFGAG
PIGIGLWFALRGKGLENVYVVEPSADRRSAVEALGARTLDPTDVDVPAFVADATDGRGAD
AVYDAAGVRPAVETALACVGSRRPMVSVAIYETPLETPLLNLVMNESRIQGSLCYTAADY
EAVIALMDAGTYDTTGWVEHIALEDVVTEGFDALHAGRKTKVLVDPTR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgtctaccacggaccccaccgagtcgagatcgaggacgtgcccaccccg
gagccgggtccgggggaggtggccgtcgacgtcgcgttcaacggcatctgcggcacggac
ctgcacgagtactacgccggcccgatcttcgtgcccacctcgccgcacccgctgacgggg
cggcaggcgccgctgacgatgggccacgagttctcgggaaccgtcgccgccgtcggaccc
ggcgtggacggctgggcggtgggcgatcgggtcgcggtcgagccgatccaccgctgcgga
cagtgcccgccctgccgggccggcaactacaacgtctgccagcggatcgggttccacggg
ttgatgtccgacggcggcatggccgagcgcacggtggtgccggtgcacatgctccaccgc
ctgccggactcggtgtcgctcgaactcggggctctggtcgagccgatgtccgtcgcctat
cacgcggccaccctcggcgagccgcccgccgacggcacggccctggtgttcggggcgggg
ccgatcgggatcggactctggttcgcgttgcggggcaaaggactcgagaacgtgtacgtg
gtcgagccgtcggcggaccgacgatccgccgtcgaggcactcggcgcccgcacgctggac
ccgaccgacgtcgacgtgcccgcgttcgtcgcggacgccaccgacggccgcggtgccgac
gcggtctacgacgcggcgggagtacgccccgccgtcgagacggcgttggcctgtgtcggc
tcgcgcaggccgatggtgagcgtcgcgatctacgagacgcccctcgagaccccgctgctg
aacctggtcatgaacgaatcccgcatccagggatccctctgctacaccgcggccgactac
gaggcggtgatcgccctcatggacgccgggacctacgacaccacgggatgggtcgagcac
atcgcgctcgaggacgtcgtgaccgagggtttcgacgccctgcacgccggtcgcaagacc
aaggtgctcgtcgaccccacccgctga

DBGET integrated database retrieval system