KEGG   Rhodococcus sp. PBTS 1: A3Q40_02143Help
Entry
A3Q40_02143       CDS       T05182                                 

Gene name
metX
Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00270  Cysteine and methionine metabolism
rhu00920  Sulfur metabolism
rhu01100  Metabolic pathways
rhu01110  Biosynthesis of secondary metabolites
rhu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A3Q40_02143 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A3Q40_02143 (metX)
Enzymes [BR:rhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A3Q40_02143 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     A3Q40_02143 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: AMY19519
UniProt: A0A143Q9D9
Position
2347649..2348737
Genome map
AA seq 362 aa AA seqDB search
MPVGDVVLESGAVIPDVVLAVQRWGETNADRSNVVLVEHALTGDSHVTGPAGDGHLSPGW
WTGMVGPGAPLDTDRWCVVATNVLGGCSGSTGPSSPHPDGGFWGSRFPAISIRDQVEAER
LFADAVGVDRFAAVVGGSMGGMRTLEWVVGHPDRVASALVLAVGARASADQIGTQTTQIA
AITGDRDWHGGDYLAAGTAPEHGLAIARRIAHLTYRTEHELDTRFGNASQSNEDAYHGGR
YAVQSYLEHQAAKLVRRFDAGSYTVLSEAMNRHDVGRGRGGVEAALRSVRLPVVVAGVDS
DRLYPLRQQQEIADLIPSCDGLRIIESRDGHDGFLTEPDAVSALLIATMTLADEALSAPS
PS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcggcgacgtcgtcctcgagagcggggccgtgatccccgatgtcgttctcgcc
gtccagcgttggggcgagacgaacgccgaccggtccaacgtcgtcctggtcgagcacgca
ctgaccggcgactcccacgtcaccgggccggccggagacggccacctgtcccccggctgg
tggaccggaatggtcggtccgggcgcgccgttggacaccgaccggtggtgcgtcgtcgcc
accaacgttctgggcgggtgctcgggcagtaccggtccgtcgtccccccatcccgacggc
gggttctggggttcccgcttccctgcgatctccatccgcgaccaggtcgaggcggagagg
ctcttcgcggacgccgtcggcgtcgaccgtttcgccgccgtggtcggcggctcgatgggc
ggaatgcggacgctcgaatgggtggtggggcacccggaccgtgtcgcctccgcactcgtg
ctcgccgtcggcgcccgcgcctcggcggaccagatcggcacccagaccacccagatcgcc
gcgatcaccggagaccgcgactggcacggtggcgactacctcgccgcgggtaccgcgccc
gagcacgggctcgcgatcgcgcggcgcatcgcccacctgacctaccggacggaacacgaa
ctcgacacgcggttcggcaacgcctcccagagcaacgaggacgcgtaccacgggggccgc
tacgcggtgcagagctacctcgagcatcaggccgccaagctggttcgccgattcgacgcc
ggcagctacacggtgctgagcgaggccatgaaccgtcacgacgtcggccgcgggcgcggc
ggagtggaggccgcgctgcggtccgtgcgccttccggtcgtggtggccggcgtcgactcc
gaccggctctacccgctccgtcagcagcaggagatcgccgacctgattccgtcctgtgac
gggctgcgcatcatcgagtcgcgcgacggccacgacgggttcctcaccgagccggacgcc
gtctccgcattgttgatcgccacgatgaccctggcggacgaggccctgtccgcaccgtcg
ccctcctga

DBGET integrated database retrieval system