KEGG   Rhodococcus sp. PBTS 1: A3Q40_02340Help
Entry
A3Q40_02340       CDS       T05182                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00790  Folate biosynthesis
rhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3Q40_02340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhu04147]
    A3Q40_02340
Enzymes [BR:rhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     A3Q40_02340
Exosome [BR:rhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3Q40_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a TetR_C_16 Receptor_IA-2
Motif
Other DBs
NCBI-ProteinID: AMY19714
UniProt: A0A143QA44
Position
2552803..2553087
Genome map
AA seq 94 aa AA seqDB search
MAELLTDDDVRRVLSDLPGWSRDGDAITRTVTCASFLAGIDLVRRVADAAESADHHPDID
IRWTAITFRLSTHSAGGITDKDVTLARTIDSLIS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactgctcaccgacgacgacgtccgccgcgtgctctccgatctccccggctgg
tcgcgggacggggacgcgatcacccgcaccgtcacctgcgcgtccttcctcgccggcatc
gacctggtgcgccgggtggccgacgcggccgagtccgccgatcatcacccggacatcgac
atccggtggacggcgatcacgttccgactctccacacactccgccggcggcatcaccgac
aaggacgtcacgctcgcgcggacgatcgactcgctgatttcctga

DBGET integrated database retrieval system